Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.15 27 4.6 0.2 13 44 19 50 7 54 0.81

2 8 0.0022 0.41 10.5 0.1 21 50 55 84 51 86 0.86

3 8 0.0042 0.77 9.6 0.0 21 47 83 109 80 115 0.87

4 8 0.1 19 5.1 0.0 21 48 111 138 107 142 0.85

5 8 0.0032 0.58 10.0 0.0 21 45 139 163 136 170 0.87

6 8 0.0043 0.79 9.6 0.0 21 46 167 192 164 198 0.90

7 8 0.038 7 6.5 0.0 22 46 196 220 191 226 0.83

8 8 0.0069 1.3 8.9 0.1 21 47 223 248 219 252 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.15	27	4.6	0.2	13	44	19	50	7	54	0.81
2	8	0.0022	0.41	10.5	0.1	21	50	55	84	51	86	0.86
3	8	0.0042	0.77	9.6	0.0	21	47	83	109	80	115	0.87
4	8	0.1	19	5.1	0.0	21	48	111	138	107	142	0.85
5	8	0.0032	0.58	10.0	0.0	21	45	139	163	136	170	0.87
6	8	0.0043	0.79	9.6	0.0	21	46	167	192	164	198	0.90
7	8	0.038	7	6.5	0.0	22	46	196	220	191	226	0.83
8	8	0.0069	1.3	8.9	0.1	21	47	223	248	219	252	0.88

Coding Sequence: ATGTCCCGCGAGCGTGAGCCCCGTCACCGCACGGCTGGATCGTCAGCGTCCGTGCGTGCTCCACGCGGTGTCTGCAATGGGGAGAAGCGTCTGGAGTGTCCAGTGTGCGAGAAGCGGTTCACCTTTCGAGGTAATCTAGAAACGCACCTTCggacccacaccggggagaagcctttcgagtgcgcaGTTTGCCAGAAGAAGTTCATTCATAGTGGACATCTCAGAAGGCACCTCCgcatccacaccggggagaaacCTTTCGAGTGCACTGTTTGCAAGCAGCAGTTCACTCAAAGTGGAAGTCTCAGAATGCAccttcgcacccacaccggggagaagcctttcgagtgcacaatTTGCAAGAAGAGTTTCCCTCGTAGTGGAGATCTCGGGGAGCACCTTCGCATCCACACCGgcgagaagcctttcgagtgcgcaGTTTGCAAGAAGAGTTTCCCTCGTAGTGGAGATCTCAGGAGGCACCTTCtgacccacaccggggagaagcctttcgagtgcactgTTTGCAGGCAAAAGTTCACTCAAAGTGGAAGTCTCAGAATGCATCTTCGCatccacactggggagaaggctttcgagtgcacagtttgcaacaagaagttcaatCAAAGTGGAAGTCTCAGAGCACACCTTCggacccacaccggggagaagcctttcgagtgctcAGTTTGCAAGAAGAAGTTTGTGCAAAGGGGACATCTTCGAAGGCACCTTCTGAAACACAGCGGGGACACGCATCGTGAGTGA
Protein Sequence: MSREREPRHRTAGSSASVRAPRGVCNGEKRLECPVCEKRFTFRGNLETHLRTHTGEKPFECAVCQKKFIHSGHLRRHLRIHTGEKPFECTVCKQQFTQSGSLRMHLRTHTGEKPFECTICKKSFPRSGDLGEHLRIHTGEKPFECAVCKKSFPRSGDLRRHLLTHTGEKPFECTVCRQKFTQSGSLRMHLRIHTGEKAFECTVCNKKFNQSGSLRAHLRTHTGEKPFECSVCKKKFVQRGHLRRHLLKHSGDTHRE

Sequence clustering based on sequence similarity using MMseqs2