Tpal007085.1
Basic Information
- Insect
- Thrips palmi
- Gene Symbol
- -
- Assembly
- GCA_012932325.1
- Location
- NW:2050067-2051221[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 8 0.7 1.3e+02 2.5 0.5 13 31 19 37 7 54 0.74 2 8 0.0056 1 9.2 0.0 21 52 55 86 48 88 0.88 3 8 0.047 8.6 6.2 0.0 21 45 83 107 79 110 0.91 4 8 0.0016 0.29 11.0 0.0 21 45 111 135 107 142 0.87 5 8 0.21 39 4.1 0.0 21 46 139 164 135 170 0.83 6 8 0.0022 0.4 10.5 0.3 21 46 167 192 163 198 0.86 7 8 0.0042 0.76 9.6 0.0 21 45 195 219 191 222 0.91 8 8 0.00087 0.16 11.8 0.0 21 44 223 246 219 251 0.90
Sequence Information
- Coding Sequence
- ATGCCCCGCAAGCATCAGCCCCGTCACCGCACAGCTGGATCGTCAGCGTCCGTGCGTGCGCCACGCGGTGTCTGCAATGGTGAGAAGCGTCTGGAGTGTCCAGTGTGCGACAAGCAGTCCGCCTTCAGAAGTCAACTAGAAACGCACCTTCggacccacaccggggagaagcctttcgagtgcgcaGTTTGCCAGAAGAAGTTTAATGAAAGTGGAGATCTCAGAAAGCACGTTCGCatccacactggggagaagcctttcgtgtgcacagtttgcaagaaGAAGTTCACTGAAAGTGGAAGTCTCAGAACGCATCTTCggacccacaccggggagaagcctttcgagtgcacagtttgcaaaaGTAAGTTCACTGAAAGTGGAAGTCTGAGAAGGCACCTTCGCTCCCAtactggggagaagcctttcgagtgcatagtttgcaacaagaagttcactCTAAGTGGACATCTCAGAGTACACCTTCGggcccacaccggggagaagcctttcgagtgcgcaGTTTGCAGGCAGAAGTTCAATAGAAGTGGACATCTCAGAAGGCACCTTCGGAcccacactggggagaagcccttcgagtgcacagtttgccaGAAGAAGTTCAATGAAAGTGGAAATCTCAGAGCACAccttcgcacccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTTGTGCAAAGTGGACACCTTCGAAGGCACCTTCTGACACACAGTGGCGAGACGCATCGTGAGTGA
- Protein Sequence
- MPRKHQPRHRTAGSSASVRAPRGVCNGEKRLECPVCDKQSAFRSQLETHLRTHTGEKPFECAVCQKKFNESGDLRKHVRIHTGEKPFVCTVCKKKFTESGSLRTHLRTHTGEKPFECTVCKSKFTESGSLRRHLRSHTGEKPFECIVCNKKFTLSGHLRVHLRAHTGEKPFECAVCRQKFNRSGHLRRHLRTHTGEKPFECTVCQKKFNESGNLRAHLRTHTGEKPFECTVCKKKFVQSGHLRRHLLTHSGETHRE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01435316;
- 90% Identity
- iTF_01435316;
- 80% Identity
- iTF_01435316;