Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.7 1.3e+02 2.5 0.5 13 31 19 37 7 54 0.74

2 8 0.0056 1 9.2 0.0 21 52 55 86 48 88 0.88

3 8 0.047 8.6 6.2 0.0 21 45 83 107 79 110 0.91

4 8 0.0016 0.29 11.0 0.0 21 45 111 135 107 142 0.87

5 8 0.21 39 4.1 0.0 21 46 139 164 135 170 0.83

6 8 0.0022 0.4 10.5 0.3 21 46 167 192 163 198 0.86

7 8 0.0042 0.76 9.6 0.0 21 45 195 219 191 222 0.91

8 8 0.00087 0.16 11.8 0.0 21 44 223 246 219 251 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.7	1.3e+02	2.5	0.5	13	31	19	37	7	54	0.74
2	8	0.0056	1	9.2	0.0	21	52	55	86	48	88	0.88
3	8	0.047	8.6	6.2	0.0	21	45	83	107	79	110	0.91
4	8	0.0016	0.29	11.0	0.0	21	45	111	135	107	142	0.87
5	8	0.21	39	4.1	0.0	21	46	139	164	135	170	0.83
6	8	0.0022	0.4	10.5	0.3	21	46	167	192	163	198	0.86
7	8	0.0042	0.76	9.6	0.0	21	45	195	219	191	222	0.91
8	8	0.00087	0.16	11.8	0.0	21	44	223	246	219	251	0.90

Coding Sequence: ATGCCCCGCAAGCATCAGCCCCGTCACCGCACAGCTGGATCGTCAGCGTCCGTGCGTGCGCCACGCGGTGTCTGCAATGGTGAGAAGCGTCTGGAGTGTCCAGTGTGCGACAAGCAGTCCGCCTTCAGAAGTCAACTAGAAACGCACCTTCggacccacaccggggagaagcctttcgagtgcgcaGTTTGCCAGAAGAAGTTTAATGAAAGTGGAGATCTCAGAAAGCACGTTCGCatccacactggggagaagcctttcgtgtgcacagtttgcaagaaGAAGTTCACTGAAAGTGGAAGTCTCAGAACGCATCTTCggacccacaccggggagaagcctttcgagtgcacagtttgcaaaaGTAAGTTCACTGAAAGTGGAAGTCTGAGAAGGCACCTTCGCTCCCAtactggggagaagcctttcgagtgcatagtttgcaacaagaagttcactCTAAGTGGACATCTCAGAGTACACCTTCGggcccacaccggggagaagcctttcgagtgcgcaGTTTGCAGGCAGAAGTTCAATAGAAGTGGACATCTCAGAAGGCACCTTCGGAcccacactggggagaagcccttcgagtgcacagtttgccaGAAGAAGTTCAATGAAAGTGGAAATCTCAGAGCACAccttcgcacccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTTGTGCAAAGTGGACACCTTCGAAGGCACCTTCTGACACACAGTGGCGAGACGCATCGTGAGTGA
Protein Sequence: MPRKHQPRHRTAGSSASVRAPRGVCNGEKRLECPVCDKQSAFRSQLETHLRTHTGEKPFECAVCQKKFNESGDLRKHVRIHTGEKPFVCTVCKKKFTESGSLRTHLRTHTGEKPFECTVCKSKFTESGSLRRHLRSHTGEKPFECIVCNKKFTLSGHLRVHLRAHTGEKPFECAVCRQKFNRSGHLRRHLRTHTGEKPFECTVCQKKFNESGNLRAHLRTHTGEKPFECTVCKKKFVQSGHLRRHLLTHSGETHRE

Sequence clustering based on sequence similarity using MMseqs2