Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0043 0.79 9.6 0.0 21 46 27 52 15 58 0.83

2 7 7.6e-05 0.014 15.2 0.0 21 46 55 80 51 86 0.86

3 7 0.00089 0.16 11.8 0.0 21 47 83 109 79 114 0.86

4 7 0.053 9.8 6.1 0.0 21 44 111 134 109 138 0.91

5 7 0.005 0.92 9.4 0.0 21 47 139 165 135 171 0.85

6 7 0.028 5.1 7.0 0.1 23 52 169 198 164 200 0.87

7 7 6.1 1.1e+03 -0.5 0.1 23 44 197 218 193 223 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0043	0.79	9.6	0.0	21	46	27	52	15	58	0.83
2	7	7.6e-05	0.014	15.2	0.0	21	46	55	80	51	86	0.86
3	7	0.00089	0.16	11.8	0.0	21	47	83	109	79	114	0.86
4	7	0.053	9.8	6.1	0.0	21	44	111	134	109	138	0.91
5	7	0.005	0.92	9.4	0.0	21	47	139	165	135	171	0.85
6	7	0.028	5.1	7.0	0.1	23	52	169	198	164	200	0.87
7	7	6.1	1.1e+03	-0.5	0.1	23	44	197	218	193	223	0.83

Coding Sequence: ATGCCCGTCCAGTGCGCAGTTTGCAGTCAATGGTGCGTCTCGCCGTCAGCGCTATCCGTGCATTCAAGGATCCACACCGGAGAGAAGCCCTTTGAGTGCGCGGTCTGCAAGCAGAAGTTCAGTCGGGAAGGAAACCTTCGTAAGCACCTCCGCACCCACACCGGAGAAAAGCCTTTTGAGTGCGCGGTTTGTATGAAGAAGTTCAGTCAGGACGATAACCTTCGAAGGCACCTCCGCACTCACACCGGAGAGaagccctttgagtgcacggTCTGCAAGAAGAAGTTCAGTGAGTCAGGAAACCTGAGGAAGCACCTCCTCATCCATACCggagagaagccttttgagtgcacGGTCTGCATGAAGAAGTTCAGTCAGGCAGGAGACCTTCGAAGTCACGTCCGCACTCACACCGGAGAGaagccctttgagtgcacggTCTGCAAGAAGAAGTTCAGTGAGACAGGAAACCTGAGGAAGCACCTGCTCGTACACACCGGGCACAAGCCGTTTGAATGCACGGTCTGCAGTAAAAAGTTCAGTCAAACGTCAACCCTCCGAACTCATCTTCGGATACATACTGGTAAGAAGCCCTATGAGTGTGCAGCTTGCGCCAAGAAATTTCGTCTCCCAGTTTCCCTCCGATCCCACATCCGTACCCACACTGCGGAGATGCCTTGA
Protein Sequence: MPVQCAVCSQWCVSPSALSVHSRIHTGEKPFECAVCKQKFSREGNLRKHLRTHTGEKPFECAVCMKKFSQDDNLRRHLRTHTGEKPFECTVCKKKFSESGNLRKHLLIHTGEKPFECTVCMKKFSQAGDLRSHVRTHTGEKPFECTVCKKKFSETGNLRKHLLVHTGHKPFECTVCSKKFSQTSTLRTHLRIHTGKKPYECAACAKKFRLPVSLRSHIRTHTAEMP

Sequence clustering based on sequence similarity using MMseqs2