Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.01 1.9 8.3 0.0 21 46 27 52 22 58 0.86

2 9 0.033 5.9 6.8 0.0 21 46 55 80 51 86 0.86

3 9 0.053 9.7 6.1 0.0 21 46 83 108 79 114 0.84

4 9 1 1.8e+02 2.0 0.0 21 45 111 135 107 138 0.86

5 9 0.0092 1.7 8.5 0.0 21 51 139 169 135 171 0.86

6 9 0.99 1.8e+02 2.0 0.0 21 46 167 192 163 198 0.83

7 9 0.018 3.2 7.6 0.0 21 46 195 220 189 226 0.86

8 9 0.00017 0.031 14.1 0.1 21 45 223 247 219 251 0.91

9 9 0.0025 0.45 10.3 0.1 21 45 251 275 247 280 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.01	1.9	8.3	0.0	21	46	27	52	22	58	0.86
2	9	0.033	5.9	6.8	0.0	21	46	55	80	51	86	0.86
3	9	0.053	9.7	6.1	0.0	21	46	83	108	79	114	0.84
4	9	1	1.8e+02	2.0	0.0	21	45	111	135	107	138	0.86
5	9	0.0092	1.7	8.5	0.0	21	51	139	169	135	171	0.86
6	9	0.99	1.8e+02	2.0	0.0	21	46	167	192	163	198	0.83
7	9	0.018	3.2	7.6	0.0	21	46	195	220	189	226	0.86
8	9	0.00017	0.031	14.1	0.1	21	45	223	247	219	251	0.91
9	9	0.0025	0.45	10.3	0.1	21	45	251	275	247	280	0.89

Coding Sequence: ATGAGCCACGGGTGTCCAGTACGCGGTAAGAAAAATGTGTCCGGGTCCAAACTGGCTGTGCACCTCCGGACCCACACAGGAGAGAAGCCCTATGAGTGCGCAGTTTGTAACAAGAAGTTCATCCAAGTTAGCGACCTCAGAAAGCACCTCCGGACCCACACAGGAGAGaagccctttgagtgcacagtttgtAACAAGACATTCAGCGTAAATAGCAACCTCAAAAAGCACCTCCGGACCCACTCAGGAGAGaagccctttgagtgcacagtttgcaacaagaagttcagccTAGGTGGCCACCTCAGAAGGCATCTCCGGACCCACACTGGAGAGAAGCCCTTtcagtgcacagtttgcaacaagaagtttagCCTAGGTGACCACCTCAGAACGCATCTCCGGACCCACACTGAAGAGaagccctttgagtgcacagtttgcaacaagaagttcagccAAGGCAGCGAGCTCCGAACGCATCTCCGAGTCCACACTGGAGAGaagccctttgagtgcacagtttgcaacaagaagttcagccTAGGTGGCCACCTCAGAACGCACCTCCGTACCCACACTGGAGAGaagccctttgagtgcacagtttgcaacaagaagttcagccAAGGCAGCGAGCTCCGAACGCATCTCCGGACCCACACTGGAGAGaagccctttgagtgcacagtttgctaCAAGAAGTTTAGTCAAATCAGCAACCTCCGAACGCATCTCCGGACCCACACAGGCGAGaagccctttgagtgcacagtttgcaacaagaagttcagtcACGGTTTGAACCTCAGAAGGCACCTCCAGACCCACTACAGTTTGCAGCAAGAGGTTTAG
Protein Sequence: MSHGCPVRGKKNVSGSKLAVHLRTHTGEKPYECAVCNKKFIQVSDLRKHLRTHTGEKPFECTVCNKTFSVNSNLKKHLRTHSGEKPFECTVCNKKFSLGGHLRRHLRTHTGEKPFQCTVCNKKFSLGDHLRTHLRTHTEEKPFECTVCNKKFSQGSELRTHLRVHTGEKPFECTVCNKKFSLGGHLRTHLRTHTGEKPFECTVCNKKFSQGSELRTHLRTHTGEKPFECTVCYKKFSQISNLRTHLRTHTGEKPFECTVCNKKFSHGLNLRRHLQTHYSLQQEV

Sequence clustering based on sequence similarity using MMseqs2