Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.45 83 3.1 0.6 13 34 19 40 7 54 0.73

2 8 0.01 1.8 8.4 0.0 21 46 55 80 49 86 0.86

3 8 5.2e-05 0.0096 15.7 0.1 21 52 83 114 79 115 0.87

4 8 0.0031 0.57 10.0 0.1 21 46 111 136 109 142 0.87

5 8 0.0033 0.61 9.9 0.1 21 46 139 164 135 170 0.86

6 8 0.0039 0.72 9.7 0.0 21 46 167 192 163 198 0.86

7 8 0.015 2.7 7.9 0.0 21 50 195 224 191 226 0.86

8 8 0.0053 0.96 9.3 0.0 21 44 223 246 221 251 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.45	83	3.1	0.6	13	34	19	40	7	54	0.73
2	8	0.01	1.8	8.4	0.0	21	46	55	80	49	86	0.86
3	8	5.2e-05	0.0096	15.7	0.1	21	52	83	114	79	115	0.87
4	8	0.0031	0.57	10.0	0.1	21	46	111	136	109	142	0.87
5	8	0.0033	0.61	9.9	0.1	21	46	139	164	135	170	0.86
6	8	0.0039	0.72	9.7	0.0	21	46	167	192	163	198	0.86
7	8	0.015	2.7	7.9	0.0	21	50	195	224	191	226	0.86
8	8	0.0053	0.96	9.3	0.0	21	44	223	246	221	251	0.91

Coding Sequence: ATGTCCCGCGAGCGTGAGCCCCGTCACCGCACGGCTGGATCGTCAGCGTCCGTGCGTGCTCCACGCGGTGCCTGCAATGGAGAGAAGCGTCTGGAGTGTCCGGTGTGCGAGAAGCAGTTCGCCTTTAGAAGTAAACTAGAAACGCACCTTCGGACCCACACCggagagaagcctttcgagtgcacagtttgtcAGACGAAGTTCGCTGTAAGTGGAGATCTCAGAAAGCACCTTCggacccacaccggggagaagcctttcgagtgcccAGTTTGCAAGCAGAAGTTCAATCATAGTGGACATCTCAGAAGGCACCTCCgcatccacaccggggagaagcctttcgagtgcgcaGTTTGCAGGCAGAAGTTCAATCAAAGTGGACATCTCCGAAACCAccttcgcacccacaccggggagaagccttacgagtgcacagtttgtcAGACGAAGTTCGCTGTAAGTGGAGCTCTCAGAAGGCAccttcgcacccacaccggagagaagcctttcgagtgcacagtttgtcAGAAGAAGTTCGCTGTAAGTGGAGATCTCAGAAGGCAccttcgcacccacaccggagagaagcctttcgagtgcacagtttgtcAGACGAAGTTCGCTGTAAGTGGAGATCTCAGAACGCACCTTcggatccacaccggggagaagccttacgagtgcacagtttgcaagaaGAAGTTTGTGCAAAGTGGACATCTTCGAAAGCACCTTCTGACACACAGCGGGGACACGCATCGTGAGTGA
Protein Sequence: MSREREPRHRTAGSSASVRAPRGACNGEKRLECPVCEKQFAFRSKLETHLRTHTGEKPFECTVCQTKFAVSGDLRKHLRTHTGEKPFECPVCKQKFNHSGHLRRHLRIHTGEKPFECAVCRQKFNQSGHLRNHLRTHTGEKPYECTVCQTKFAVSGALRRHLRTHTGEKPFECTVCQKKFAVSGDLRRHLRTHTGEKPFECTVCQTKFAVSGDLRTHLRIHTGEKPYECTVCKKKFVQSGHLRKHLLTHSGDTHRE

Sequence clustering based on sequence similarity using MMseqs2