Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.094 17 5.3 0.6 13 45 19 51 7 55 0.82

2 10 0.35 64 3.4 0.0 22 49 56 83 52 86 0.85

3 10 0.00011 0.019 14.7 0.1 21 50 83 112 79 114 0.87

4 10 0.14 25 4.8 0.0 21 52 111 142 108 143 0.87

5 10 0.013 2.3 8.1 0.0 21 45 139 163 136 166 0.92

6 10 0.0099 1.8 8.4 0.0 21 46 167 192 163 198 0.86

7 10 0.055 10 6.0 0.1 21 50 195 224 191 226 0.86

8 10 0.023 4.3 7.2 0.0 21 50 223 252 219 254 0.87

9 10 0.035 6.4 6.6 0.0 21 50 251 280 249 282 0.87

10 10 0.013 2.4 8.0 0.1 21 44 279 302 275 307 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.094	17	5.3	0.6	13	45	19	51	7	55	0.82
2	10	0.35	64	3.4	0.0	22	49	56	83	52	86	0.85
3	10	0.00011	0.019	14.7	0.1	21	50	83	112	79	114	0.87
4	10	0.14	25	4.8	0.0	21	52	111	142	108	143	0.87
5	10	0.013	2.3	8.1	0.0	21	45	139	163	136	166	0.92
6	10	0.0099	1.8	8.4	0.0	21	46	167	192	163	198	0.86
7	10	0.055	10	6.0	0.1	21	50	195	224	191	226	0.86
8	10	0.023	4.3	7.2	0.0	21	50	223	252	219	254	0.87
9	10	0.035	6.4	6.6	0.0	21	50	251	280	249	282	0.87
10	10	0.013	2.4	8.0	0.1	21	44	279	302	275	307	0.91

Coding Sequence: ATGTCCCGCGAGCGTGAGCCCCGTCACCGCACAGCTGGATCGTCAGCGTCCGTGCGTGCTCCACGCGGTGTCTGCAATGGAGAGAAGCGTCTGGAGTGCCCAGTGTGCGAGAAGCAGTTCGCCTTTAGAAGTCAACTAGAAAGGCACCTTCAGACCCACACCGAGGAGATGCCTTTCGAttgcacagtttgcaagaaGAAGTTCGCTAACAATGCACATCTCCGAACGCACCTTCGCatccacactggggagaagcctttcgagtgcacagtttgccaGAAGAAGTTCAATGAAAGTGGTAATCTCAGAAGGCACCTTCgcatccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCGCTAACAATGGAGATCTCCGAACGCACCTTCGCATtcacactggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCAATCAAAGTGGATATCTCAGAACGCACCTTCGCAcgcacaccggggagaagccttttcAGTGCACAGTTTGCGGGCAGAAGTTCAGTCAAAGTGGAGGTCTCAGAACGCATCTTCggacccacaccggggagaagccttttgagtgcGTAGTTTGCAAGAAGAGCTTCAATGAATGTGGAAGTCTCAGAAAGCACCTTCgcatccacaccggggagaagcctttcgagtgcacagtttgcaacaagaagttcactGAAAGTGGAAGTCTCAGAACGCATCTTCgaatccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCACTAAAAGTGGACACCTTAGAGGTCACCTCCGCatccacactggggagaagcctttcgagtgcacagtgtgcAAGAAGAAGTTTGTTCAAAGTGCACATCTTCGTACACACCTTCTGACGCACAGCGGGGACAAGCATCGTGAGTGA
Protein Sequence: MSREREPRHRTAGSSASVRAPRGVCNGEKRLECPVCEKQFAFRSQLERHLQTHTEEMPFDCTVCKKKFANNAHLRTHLRIHTGEKPFECTVCQKKFNESGNLRRHLRIHTGEKPFECTVCKKKFANNGDLRTHLRIHTGEKPFECTVCKKKFNQSGYLRTHLRTHTGEKPFQCTVCGQKFSQSGGLRTHLRTHTGEKPFECVVCKKSFNECGSLRKHLRIHTGEKPFECTVCNKKFTESGSLRTHLRIHTGEKPFECTVCKKKFTKSGHLRGHLRIHTGEKPFECTVCKKKFVQSAHLRTHLLTHSGDKHRE

Sequence clustering based on sequence similarity using MMseqs2