Basic Information

Insect: Thrips palmi
Gene Symbol: -
Assembly: GCA_012932325.1
Location: NW:1510790-1515351[-]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 12 0.74 1.4e+02 2.4 0.0 24 45 19 40 2 47 0.75

2 12 0.062 11 5.9 0.0 21 46 44 69 38 75 0.86

3 12 0.077 14 5.6 0.0 21 45 72 96 68 102 0.90

4 12 0.56 1e+02 2.8 0.0 22 45 101 124 96 132 0.86

5 12 0.0077 1.4 8.7 0.0 22 45 129 152 126 158 0.87

6 12 0.0021 0.39 10.6 0.1 22 46 157 181 153 187 0.87

7 12 0.12 22 4.9 0.0 22 45 185 208 182 214 0.87

8 12 0.032 5.9 6.8 0.0 22 46 213 237 209 243 0.87

9 12 0.74 1.3e+02 2.4 0.0 22 49 241 268 238 271 0.82

10 12 0.0029 0.54 10.1 0.0 21 46 268 293 264 300 0.89

11 12 1.4 2.6e+02 1.5 0.0 22 46 297 321 294 327 0.81

12 12 0.0082 1.5 8.7 0.0 21 45 324 348 320 351 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	12	0.74	1.4e+02	2.4	0.0	24	45	19	40	2	47	0.75
2	12	0.062	11	5.9	0.0	21	46	44	69	38	75	0.86
3	12	0.077	14	5.6	0.0	21	45	72	96	68	102	0.90
4	12	0.56	1e+02	2.8	0.0	22	45	101	124	96	132	0.86
5	12	0.0077	1.4	8.7	0.0	22	45	129	152	126	158	0.87
6	12	0.0021	0.39	10.6	0.1	22	46	157	181	153	187	0.87
7	12	0.12	22	4.9	0.0	22	45	185	208	182	214	0.87
8	12	0.032	5.9	6.8	0.0	22	46	213	237	209	243	0.87
9	12	0.74	1.3e+02	2.4	0.0	22	49	241	268	238	271	0.82
10	12	0.0029	0.54	10.1	0.0	21	46	268	293	264	300	0.89
11	12	1.4	2.6e+02	1.5	0.0	22	46	297	321	294	327	0.81
12	12	0.0082	1.5	8.7	0.0	21	45	324	348	320	351	0.90

Sequence Information

Coding Sequence: ATGGCCACATCGTCACCGGATACGCGTCAACGCGGGAAGCGCCGAGGCGGAGAGACCTTCGAATGTGCAGTGTGCTGGAAGAAGTTCGGCCGAAGTGATACACTAAGAGAGCACGTTCggacccacaccggggagaagcctttcgagtgcacagtatGCAAGAAGAAGTTCACTGCAAGTGCAACTCTCAGAACGCATCTTCggacccacaccggggagaagcctttcgagtgcgcaGTATGCACGAAGAAATTCGCTCAAACCACAGGTCTTAGAGTGCACCTCCGGAcacacaccggggagaagtctttcgagtgcacagtatgcaacaagaagttcactCGAAGTGGAAGCCTTAGAGAGCACCTTCAGAcacacaccggggagaagtctttcgagtgcacagtgtgcaacaagaagttcgtTCAAAGTCGGGGCCTTAGAGAGCACCTTCAGAcacacaccggggagaagtcTTTTGAGTGCACAATATGCACGAAGAAGTTCAGTTTCAGTAGTAATTTACGAAGGCACCTACGGATCCACACCGGAGAGAAgtctttcgagtgcacagtatgcaacaagaagttcgtTCAAAGTGGAAGCCTTAGAGAGCACCTTCAGAcacacaccggggagaagtcTTTCGAGTGCACAATATGCACGAAGAAGTTCAGTTTCAGTAGTAATTTACGAAGTCACCTACGGATCCACACCGGAGAGAAgtctttcgagtgcacagtatGCAAGACGAAGTTCGGTAGCAGTAGTTATTTAAGAGTGCACCTACGGATACACTCTggagagaagcctttcgagtgctcAGTATGCAAGAAGAAGTTCGGTGTCAGTAGTAATTTACGAAAGCACCTACGGATCCACACCGGAGAAAAgtctttcgagtgcacagtatGCAAGAAGAAGTTCGGTACCAGTAGTGAATTAAGAGTGCACCTTCGGACTCACACCGgcgagaagcctttcgagtgctcAGTATGCAAGAAGAAGTTCGTTCATAAAGGAAACCTCAGAAGGCACCTCCGGACCCACAGCGGGTAG
Protein Sequence: MATSSPDTRQRGKRRGGETFECAVCWKKFGRSDTLREHVRTHTGEKPFECTVCKKKFTASATLRTHLRTHTGEKPFECAVCTKKFAQTTGLRVHLRTHTGEKSFECTVCNKKFTRSGSLREHLQTHTGEKSFECTVCNKKFVQSRGLREHLQTHTGEKSFECTICTKKFSFSSNLRRHLRIHTGEKSFECTVCNKKFVQSGSLREHLQTHTGEKSFECTICTKKFSFSSNLRSHLRIHTGEKSFECTVCKTKFGSSSYLRVHLRIHSGEKPFECSVCKKKFGVSSNLRKHLRIHTGEKSFECTVCKKKFGTSSELRVHLRTHTGEKPFECSVCKKKFVHKGNLRRHLRTHSG

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01435169;
90% Identity: iTF_01435169;
80% Identity: iTF_01435169;