Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.057 10 6.0 0.4 13 46 19 52 7 58 0.81

2 10 0.039 7.1 6.5 0.0 21 46 55 80 51 86 0.85

3 10 0.045 8.2 6.3 0.1 21 47 83 109 79 115 0.85

4 10 0.2 36 4.3 0.0 21 45 111 135 108 138 0.91

5 10 0.0049 0.89 9.4 0.0 21 46 139 164 135 170 0.86

6 10 0.0046 0.85 9.5 0.0 21 46 167 192 163 198 0.86

7 10 0.17 32 4.4 0.0 21 45 195 219 191 222 0.90

8 10 0.016 2.9 7.7 0.0 21 45 223 247 219 251 0.91

9 10 0.0075 1.4 8.8 0.0 21 46 251 276 247 282 0.86

10 10 0.14 25 4.7 0.0 21 44 279 302 275 307 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.057	10	6.0	0.4	13	46	19	52	7	58	0.81
2	10	0.039	7.1	6.5	0.0	21	46	55	80	51	86	0.85
3	10	0.045	8.2	6.3	0.1	21	47	83	109	79	115	0.85
4	10	0.2	36	4.3	0.0	21	45	111	135	108	138	0.91
5	10	0.0049	0.89	9.4	0.0	21	46	139	164	135	170	0.86
6	10	0.0046	0.85	9.5	0.0	21	46	167	192	163	198	0.86
7	10	0.17	32	4.4	0.0	21	45	195	219	191	222	0.90
8	10	0.016	2.9	7.7	0.0	21	45	223	247	219	251	0.91
9	10	0.0075	1.4	8.8	0.0	21	46	251	276	247	282	0.86
10	10	0.14	25	4.7	0.0	21	44	279	302	275	307	0.89

Coding Sequence: ATGTCCCGCGAGCGTGAGCCCCGTCACCGCACGGCTGGATCGTCAGCGTCCGTGCGTGCTCCACGCGGTGTCTGCAATGGAGAGAAGCGTCTGGAGTGTCCAGTGTGCGAGAAGCAGTTCGCCTCAAGAAGTAACCTAGAAGCGCACCTTCGGACCCACACCGAGGAGAAGCccttcgagtgcacagtttgcaggAAGAGCTTCACTGAAAGTGGAAGTCTCAGTAGGCATCTTCggacccacaccggggagaagcctttcgagtgcgcaGTTTGCAGGCAGAAGTTCAGTCGAAGTGGTAGTCTCAGAGCACACCTTCGCAcacacaccggggagaagccttttgagtgcacagtttgcggGCAGAAGTTCAATCATAGTGGAGGTCTCAGAACGCATCTTCggacccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCACTCAAAGTGGAAGTCTCAGAACGCAccttcgcacccacaccggggagaagccatttgagtgcacagtttgccgGAAGAAGTTCGCTCAAAGTGGAGATCTCAGAGCACAccttcgcacccacaccggggagaagccttttgagtgcacagtttgcggGCAGAAGTTCAATCATAGTGGAGGTCTCAGAACGCATCTTCggacccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCAATGAAAGTGGAGATCTTAGAAAGCACCTTCGCAcgcacaccggggagaagcctttcgagtgcacagtttgcaagaaCAAGTTCAATGAAAGTGGAGATCTTAGAAAGCACCTTCGCAcgcacaccggggagaagcctttcgagtgtaCAGTTTGCAAGAAGAAGTTTGTTCGTAGTGGACATCTTCGAACGCACCTCCTGACGCACACCCGGGACACGCATCGTGAGTGA
Protein Sequence: MSREREPRHRTAGSSASVRAPRGVCNGEKRLECPVCEKQFASRSNLEAHLRTHTEEKPFECTVCRKSFTESGSLSRHLRTHTGEKPFECAVCRQKFSRSGSLRAHLRTHTGEKPFECTVCGQKFNHSGGLRTHLRTHTGEKPFECTVCKKKFTQSGSLRTHLRTHTGEKPFECTVCRKKFAQSGDLRAHLRTHTGEKPFECTVCGQKFNHSGGLRTHLRTHTGEKPFECTVCKKKFNESGDLRKHLRTHTGEKPFECTVCKNKFNESGDLRKHLRTHTGEKPFECTVCKKKFVRSGHLRTHLLTHTRDTHRE

Sequence clustering based on sequence similarity using MMseqs2