Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.086 16 5.4 0.3 13 44 19 50 7 55 0.79

2 10 0.0016 0.29 11.0 0.0 21 47 55 81 51 87 0.86

3 10 0.64 1.2e+02 2.6 0.0 21 45 83 107 79 110 0.89

4 10 0.0069 1.3 8.9 0.1 21 46 111 136 107 142 0.86

5 10 0.0011 0.2 11.4 0.0 21 47 139 165 135 170 0.85

6 10 0.01 1.9 8.4 0.0 21 46 167 192 164 198 0.87

7 10 0.0054 0.98 9.3 0.1 21 46 195 220 192 226 0.90

8 10 1.2 2.1e+02 1.8 0.0 22 45 224 247 221 250 0.86

9 10 0.0041 0.74 9.6 0.0 21 46 251 276 247 282 0.86

10 10 0.009 1.6 8.5 0.1 21 47 279 304 275 308 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.086	16	5.4	0.3	13	44	19	50	7	55	0.79
2	10	0.0016	0.29	11.0	0.0	21	47	55	81	51	87	0.86
3	10	0.64	1.2e+02	2.6	0.0	21	45	83	107	79	110	0.89
4	10	0.0069	1.3	8.9	0.1	21	46	111	136	107	142	0.86
5	10	0.0011	0.2	11.4	0.0	21	47	139	165	135	170	0.85
6	10	0.01	1.9	8.4	0.0	21	46	167	192	164	198	0.87
7	10	0.0054	0.98	9.3	0.1	21	46	195	220	192	226	0.90
8	10	1.2	2.1e+02	1.8	0.0	22	45	224	247	221	250	0.86
9	10	0.0041	0.74	9.6	0.0	21	46	251	276	247	282	0.86
10	10	0.009	1.6	8.5	0.1	21	47	279	304	275	308	0.88

Coding Sequence: ATGCCCCGCGAGCATCAGCCCCGTCACCGCACAGCTGGATCGTCAGCGTCCGTGCGTGCTCCACGCGGTGTCTGCAATGGTGAGAAGCGTCTGGAGTGTCCAGTGTGCGACAAGCAGTTCGCCTTCAGAAGGCAACTAGAAACGCACCTTCggacccacaccggggagaagcctttcgagtgcacagtttgcaaaaGTAAGTTCACTGAAAGTGGAAGTCTGAGAAGGCAccttcgcacccacactggggagaagcctttcgagtgcatagtttgcaacaagaagttcactCTAAGTGGACATCTCAGAGTACACCTTCGggcccacaccggggagaagcctttcgagtgcacagtttgccaGAAGAAGTTCAATCTAAGTGGACATCTCAGAAGGCAccttcgcacccacaccgaggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCAATGAAAGTGGAAATCTCAGAAAGCACCTTtggatccacaccggggagaagcctttcgagtgcacagtttgcaacaagaagttcagtcTAAGTGGACATCTCAGGAGGCACCTTCggacccacaccggggagaagcctttcgagtgcactgTTTGCAGGCAAAACTTCACTCAAAGTGGAAGTCTCAGAATGCATCTTCGCatccacactggggagaaggctttcgagtgcacagtttgcaacaagaagttcaatCGAAGTGGTGTTCTCCGAAACCAccttcgcacccacaccggggagaaacctttcgagtgcacagtttgcaacaagaagttcaatCAAAGTGGAAGTCTCAGAGCACACCTCCggacccacaccggggagaagcctttcgagtgctcAGTTTGCAAGAAGAAGTTTGTGCAAAGGGGACATCTTCGAAGGCACCTTCTGAAACACAGCGGGGACACGCATCGTGAGTGA
Protein Sequence: MPREHQPRHRTAGSSASVRAPRGVCNGEKRLECPVCDKQFAFRRQLETHLRTHTGEKPFECTVCKSKFTESGSLRRHLRTHTGEKPFECIVCNKKFTLSGHLRVHLRAHTGEKPFECTVCQKKFNLSGHLRRHLRTHTEEKPFECTVCKKKFNESGNLRKHLWIHTGEKPFECTVCNKKFSLSGHLRRHLRTHTGEKPFECTVCRQNFTQSGSLRMHLRIHTGEKAFECTVCNKKFNRSGVLRNHLRTHTGEKPFECTVCNKKFNQSGSLRAHLRTHTGEKPFECSVCKKKFVQRGHLRRHLLKHSGDTHRE

Sequence clustering based on sequence similarity using MMseqs2