Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.48 88 3.0 0.5 13 44 19 50 7 55 0.72

2 9 0.00016 0.03 14.1 0.1 21 46 55 80 49 86 0.85

3 9 0.044 8.1 6.3 0.1 21 46 83 108 79 114 0.86

4 9 0.01 1.9 8.3 0.0 21 44 111 134 107 137 0.91

5 9 0.0067 1.2 8.9 0.0 21 45 139 163 135 166 0.91

6 9 0.0098 1.8 8.4 0.0 21 46 167 192 163 198 0.86

7 9 0.011 2 8.3 0.0 21 45 195 219 191 223 0.91

8 9 0.012 2.2 8.1 0.0 21 45 223 247 219 250 0.91

9 9 0.12 22 4.9 0.0 21 44 251 274 247 279 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.48	88	3.0	0.5	13	44	19	50	7	55	0.72
2	9	0.00016	0.03	14.1	0.1	21	46	55	80	49	86	0.85
3	9	0.044	8.1	6.3	0.1	21	46	83	108	79	114	0.86
4	9	0.01	1.9	8.3	0.0	21	44	111	134	107	137	0.91
5	9	0.0067	1.2	8.9	0.0	21	45	139	163	135	166	0.91
6	9	0.0098	1.8	8.4	0.0	21	46	167	192	163	198	0.86
7	9	0.011	2	8.3	0.0	21	45	195	219	191	223	0.91
8	9	0.012	2.2	8.1	0.0	21	45	223	247	219	250	0.91
9	9	0.12	22	4.9	0.0	21	44	251	274	247	279	0.89

Coding Sequence: ATGTCCCGCGAGCGTGAGCCCCGTCACCGCACGGCTGGATCGTCAGCGTCCGTGCGTGCTCCACGCGGTGTCTGCAATGGAGAGAAGCGTCTGGAGTGTCCAGTGTGCGAGAAGCAGTTCGCCTCAAGAAGTAAGCTAGAAGCGCACCTTCGGACCCACACCGAGGAGAAGCccttcgagtgcacagtttgcaggAAGAGCTTCACTGAAAGTGGAAATCTCAGAAGGCATCTTCggacccacaccggggagaagcctttcgagtgcgcaGTTTGCAGGCAGAAGTTCAGTCGAAGTGGTAGTCTCAGAGCACACCTTCGCAcacacaccggggagaagcctttcgagtgcaaaGTTTGCAAGAAGAAGTTCACTCAAAGTGGAAGTCTCAGAACGCACCTTCGCACcgacaccggggagaagccatttgagtgcacagtttgccgGAAGAAGTTCGCTCAAAGTGGAGATCTCAGAGCACACCTTCGCAcacacaccggggagaagcctttcgagtgcaaaGTTTGCAAGAAGAAGTTCGCTCAAAGTGGACATCTTAGAGTACAccttcgcacccacaccggggagaagcctttcgagtgcacagtttgcaagaaTAAGTTCAATGAAAGTGGAGATCTTAGAAAGCACCTTCGCAcgcacaccggggagaagcctttcgagtgcacagtttgcaggAATAAGTTCAATGAAAGTGGAGATCTTAGAAAGCATCTTCGCAcgcacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTTGTTCGTAGTGGACATCTTCGAACTCACCTCCTGACGCACACCCGGGACACGCATCGTGAGTGA
Protein Sequence: MSREREPRHRTAGSSASVRAPRGVCNGEKRLECPVCEKQFASRSKLEAHLRTHTEEKPFECTVCRKSFTESGNLRRHLRTHTGEKPFECAVCRQKFSRSGSLRAHLRTHTGEKPFECKVCKKKFTQSGSLRTHLRTDTGEKPFECTVCRKKFAQSGDLRAHLRTHTGEKPFECKVCKKKFAQSGHLRVHLRTHTGEKPFECTVCKNKFNESGDLRKHLRTHTGEKPFECTVCRNKFNESGDLRKHLRTHTGEKPFECTVCKKKFVRSGHLRTHLLTHTRDTHRE

Sequence clustering based on sequence similarity using MMseqs2