Basic Information

Insect: Thrips palmi
Gene Symbol: -
Assembly: GCA_012932325.1
Location: NW:10906621-10911089[-]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 12 0.62 1.1e+02 2.7 0.2 15 48 21 54 15 58 0.85

2 12 0.0017 0.31 10.9 0.0 21 52 55 86 51 88 0.87

3 12 4.4 8.1e+02 -0.1 0.0 23 46 85 108 79 114 0.82

4 12 0.024 4.3 7.2 0.0 20 52 110 142 92 143 0.84

5 12 0.037 6.8 6.6 0.0 22 52 140 170 135 172 0.87

6 12 5.8 1.1e+03 -0.5 0.0 22 46 168 192 165 198 0.69

7 12 0.028 5.1 7.0 0.0 21 45 195 219 187 225 0.89

8 12 0.0011 0.19 11.5 0.0 21 46 223 248 219 254 0.87

9 12 0.0031 0.56 10.0 0.0 21 46 251 276 247 282 0.86

10 12 0.02 3.6 7.4 0.0 21 50 279 308 275 310 0.86

11 12 0.025 4.6 7.1 0.0 21 44 307 330 303 338 0.88

12 12 0.00052 0.096 12.5 0.1 21 45 335 359 330 362 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	12	0.62	1.1e+02	2.7	0.2	15	48	21	54	15	58	0.85
2	12	0.0017	0.31	10.9	0.0	21	52	55	86	51	88	0.87
3	12	4.4	8.1e+02	-0.1	0.0	23	46	85	108	79	114	0.82
4	12	0.024	4.3	7.2	0.0	20	52	110	142	92	143	0.84
5	12	0.037	6.8	6.6	0.0	22	52	140	170	135	172	0.87
6	12	5.8	1.1e+03	-0.5	0.0	22	46	168	192	165	198	0.69
7	12	0.028	5.1	7.0	0.0	21	45	195	219	187	225	0.89
8	12	0.0011	0.19	11.5	0.0	21	46	223	248	219	254	0.87
9	12	0.0031	0.56	10.0	0.0	21	46	251	276	247	282	0.86
10	12	0.02	3.6	7.4	0.0	21	50	279	308	275	310	0.86
11	12	0.025	4.6	7.1	0.0	21	44	307	330	303	338	0.88
12	12	0.00052	0.096	12.5	0.1	21	45	335	359	330	362	0.90

Sequence Information

Coding Sequence: ATGGCCCTTGAGAGTGCACAgtgcggcgaggtggcggcatcgtcagcggcgccgcgtgctccACGGGGAAAGCGTGGAGGGCAGCAGGCGCTCCACTGTGCAGTCTGCGAGAAGGAGTTCCGATGCAAGAGTGTCCTCCAGGCGCACTTGcggatccacaccggggagaagcctttcgagtgcacgtTCTGCGAGGAGAAGTTTGCTCAAAGTGGAAACCTAACAAGGCACCTTCGCACCCACACCAAGGTGAAGCCGTTTGAGTGCGTAGTTTGCCAGAAGAAGTTCTCTCACAGTGAGGGTCTAAAATTGCACCTTCggacccacaccggggagaagcctttcgagtgcgcaGTTTGTCTGAAGAAGTTTTCAGTGAGTGGGAGTCTGAGAACGCACCTGCGGATCCACACAAAGGACAAGCCATTCGAATGCACAATTTGCATGAAGAGTTTCTCTATGAGTGGGAGTCTGCGTGTGCACCTTcggatccacaccggggagaagcctttcgagtgcacagtgtgcAAGAACAAATTCACTGTAAGATCGAGTTTGATAGAGCACCTTCGCatccacactggggagaagcctttcgagtgcacagtttgcaagaaGGGTTTCAGGAAAGGTGGAGATCTTAGAACGCACCTACGGACCCACACCgcggagaagcctttcgagtgcacagtttgcaagaaGAGTTTCAGGAAAAGTGGAGATCTTAGAACGCACCTACggacccacaccggggagaagcctttcgagtgcaccgTTTGCAAGAAGAGTTTCAGGGCAAGTGGAGATCTTAGAACGCACCTACggacccacaccggggagaagcctttcgagtgcgcaGTTTGCAAGAACAAATTCACTGCTAGTTCGAGTTTGAGAGAGCACCTTCGCatccacactggggagaagcctttcgagtgcacagtttgcaagaaGAGTTTCAGGACAAGTGGAGATCTTAGAACGCACCAACggacccacaccggggagaagccttacgAGTGCACCGTTTGTAAGAAGAGTTTCAGTACATCCGGAAACCTCAGAAGGCATCTCAGAACCCACACTAGgtag
Protein Sequence: MALESAQCGEVAASSAAPRAPRGKRGGQQALHCAVCEKEFRCKSVLQAHLRIHTGEKPFECTFCEEKFAQSGNLTRHLRTHTKVKPFECVVCQKKFSHSEGLKLHLRTHTGEKPFECAVCLKKFSVSGSLRTHLRIHTKDKPFECTICMKSFSMSGSLRVHLRIHTGEKPFECTVCKNKFTVRSSLIEHLRIHTGEKPFECTVCKKGFRKGGDLRTHLRTHTAEKPFECTVCKKSFRKSGDLRTHLRTHTGEKPFECTVCKKSFRASGDLRTHLRTHTGEKPFECAVCKNKFTASSSLREHLRIHTGEKPFECTVCKKSFRTSGDLRTHQRTHTGEKPYECTVCKKSFSTSGNLRRHLRTHTR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01435236;
90% Identity: iTF_01435236;
80% Identity: iTF_01435236;