Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.036 5.6e+02 2.5 0.1 22 45 44 67 40 74 0.85

2 5 0.00019 2.9 9.8 0.1 22 45 72 95 67 98 0.88

3 5 0.0012 19 7.2 0.0 22 47 100 124 95 127 0.85

4 5 0.0052 82 5.2 0.1 21 46 127 152 125 156 0.91

5 5 0.0015 24 6.9 0.2 20 48 154 181 152 185 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.036	5.6e+02	2.5	0.1	22	45	44	67	40	74	0.85
2	5	0.00019	2.9	9.8	0.1	22	45	72	95	67	98	0.88
3	5	0.0012	19	7.2	0.0	22	47	100	124	95	127	0.85
4	5	0.0052	82	5.2	0.1	21	46	127	152	125	156	0.91
5	5	0.0015	24	6.9	0.2	20	48	154	181	152	185	0.86

Coding Sequence: ATGGAAGAAGCAGAACAATCAACAGGAGACCTTAAAATAACATATAATTGCCGAAGATGCAAACTGcaATTTGAAACCAAGCGAGAATCCCTACTACATAAGAAAACAGTTCACGATAATAatcttgaagaaaaaaaattcgtttgcGACATTTGTAACAAACGCTTCTCTAACCATGGAAACATGTATCGCCATCTTAAAAGTCATACCGACCACCGGCCACATAATTGTAAAATTTGCGGCAAATCATTCGCTCAAGCTACAAACTTGCAAAGACATTTTTCAGTGCACAGCGGTCAAAGGCCATTCCAATGTTCTGTGTGCGATAAGAGCTTCACACAGCCAGGCAATTTAAAAAGACATGAACTAATTCATACTGGAGAAAAGCCGTTCCGTTGCAAACGCTGTGGACGGATGTTTTCGCAACGGGTCAATTTAAAGAAGCATGTTATGCTTCATCAAGGATATAGACCTTATACGTGTACCGTTTGTAATAAATCATTTCTACAATTGCAGAACTATAAGAATCATATGAACCGCCATTTGAAAGCCGAAGAACAATCGGAAAAAAATGActtattGTACTACGAATGTGCATTATGCAGGCTAGTCTTCAATAGTTTTACAGATTTTCAAGCCCATGAGATTTTCTGTGAAGTAGCGAGTGAGGAACAGATTGAAACAACACAAGTTGTCGAAATGAAGGAAGAATag
Protein Sequence: MEEAEQSTGDLKITYNCRRCKLQFETKRESLLHKKTVHDNNLEEKKFVCDICNKRFSNHGNMYRHLKSHTDHRPHNCKICGKSFAQATNLQRHFSVHSGQRPFQCSVCDKSFTQPGNLKRHELIHTGEKPFRCKRCGRMFSQRVNLKKHVMLHQGYRPYTCTVCNKSFLQLQNYKNHMNRHLKAEEQSEKNDLLYYECALCRLVFNSFTDFQAHEIFCEVASEEQIETTQVVEMKEE

Sequence clustering based on sequence similarity using MMseqs2