Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 6.6e-39 1e-35 122.4 1.0 1 88 12 98 12 98 0.97

2 3 3.2 5e+03 -1.5 0.0 56 81 128 153 126 159 0.78

3 3 8.6 1.4e+04 -2.9 0.1 41 50 157 165 149 165 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	6.6e-39	1e-35	122.4	1.0	1	88	12	98	12	98	0.97
2	3	3.2	5e+03	-1.5	0.0	56	81	128	153	126	159	0.78
3	3	8.6	1.4e+04	-2.9	0.1	41	50	157	165	149	165	0.77

Coding Sequence: atgccgcgaccgtcgaaagaaagctacggcgaccagaaacctccgttttcctatatctcgttaaccgcgatggccatttggagctcgccgcagaaaatgctgccgctcagcgacatctacaagttcatcatggacaagtttccctactaccgcaaaaacacgcagaagtggcagaactcgctgcggcacaacctcagcttcaacgactgcttcatcaagattcccaggaacaccaacaaagccggcaaaggctcctactggacgctgcatccgaaggccttcgacatgttcgaaaacggcagcttgctgcggcgacgcaagcgcttccgagtgcagaagctggagaaggaaatcctgaacggggagctggctgcgttggccagcttcaaccgcttctttctgtcgcagcagcagcagcagcagcagacggactccccagccgcttggaacgcgcaagcggAAGCGAGGTACGCACCACGCGTTTGGCAAAACAGCCCGTCGCCAGACTATATCAGCGTTTCGAGTGCATCGCTATCGCCGGAGCCAACAGAATTGCAGCAGCCGACGTCGCTGACGCAGAGTGCAACGCGGCCGAAGCGACCGTTTACAATTGAGAATATAATTGGCCCGGATCCGAGCAGTCCTCAGAACGCCGCCGCTGAGCTGAACACGACGCCAACACCGACGGATTTTCGATATGGACAAGTGACGAATTTCGCGATGCAGAACTTCGCCGCAGCAAGCTTCCCGCTGAGGCCCACACATCACCCTGCGTTGACACTCCATCAGCAGCATCACCATGACCCCCATCACCAACATCAACTCGCTCTGCTGCGCCATCAACAAGCGATGGCCGTCCAAGCGCAGTACCAAGCGGCTCAGCAGGCGGCTGCCATGCTCGGCGATCCTCAGAACCCTTACAGAGGTTGTTACCTGGGACCACTGCCAGTGTTCTGA
Protein Sequence: MPRPSKESYGDQKPPFSYISLTAMAIWSSPQKMLPLSDIYKFIMDKFPYYRKNTQKWQNSLRHNLSFNDCFIKIPRNTNKAGKGSYWTLHPKAFDMFENGSLLRRRKRFRVQKLEKEILNGELAALASFNRFFLSQQQQQQQTDSPAAWNAQAEARYAPRVWQNSPSPDYISVSSASLSPEPTELQQPTSLTQSATRPKRPFTIENIIGPDPSSPQNAAAELNTTPTPTDFRYGQVTNFAMQNFAAASFPLRPTHHPALTLHQQHHHDPHHQHQLALLRHQQAMAVQAQYQAAQQAAAMLGDPQNPYRGCYLGPLPVF

Sequence clustering based on sequence similarity using MMseqs2