Tmat012074.1
Basic Information
- Insect
- Thalpophila matura
- Gene Symbol
- egl-13_1
- Assembly
- GCA_948465475.1
- Location
- OX419194.1:8613170-8632933[-]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5e-28 4.1e-25 88.3 3.2 1 69 187 255 187 255 0.99
Sequence Information
- Coding Sequence
- ATGGATCAAGTAAATCAAGCTTTTAAGTTCCCTGATATCATCACATCTTTCCCCAACTTTATTATCTCCCAAGAAACGAACATAGGCAACGTGACAGCTGAGCTGGAGTTGCAGCGGTTACAGCAGGAACAACTACGTCGACAGGAGATGGTGCGGCGTGGGCAGCACGGCATGTACCCTGGCCCACCCTTGGGTCTGCTGCCATTGTTGGAGCAAATGCGGCCGCAGCCTCCACAATCTAACGCGATGCAAACAAACCAGTGGCCAGCGACCGCTCAGCTCGCTCAACTCACAGCGAGCGCTCGCTCGCCGCCTCCTCAAGACCCGGACACTCCGCTCAACTTGAGCAAGCAGCGCTCCCCGTCGCCCGCGCAGCCGATGATGCTACCGCGCTTTGTACCCTACCCCCCTATGGATGAGTCCCAGTACAATATGCCGAAAGAAGAAGAATATAATGCAGCTTGCAACACATCGTCATGGAACCAATCACCTTCAGAGGATGCAGAGAAAGCGAAGCTGGTCCGCCAACCGCGTCGCGACGAGGCTGGCAAGCCTCACATCAAGCGACCAATGAACGCGTTCATGGTGTGGGCCAAGGATGAACGGAGGAAGATCCTCAAGGCGTGTCCCGACATGCACAACTCTAACATATCGAAGATCCTCGGCGCCAGGTGGAAGGCGATGTCTAATGCTGAGAAGCAACCCTATTATGAAGAGCAGTCGAGATTGTCCAAACTACATATGGAGAAGCACCCAGACTATAGgtaccgaccaagaccaaaaagaacatgcatagtcgacggcaagaagatgcggatatctgagtacaaaaacctgatgcgtactcgccggcaggagatgaggcagctgtggtgccgcgacggcggcagcgagctgggcttcctgccaccctcactctcatcccctggaccttccaactcctcaccaccacctaacggaggcaactacatgaatcccgggttctccccgccgctatcacccagggaggacgattga
- Protein Sequence
- MDQVNQAFKFPDIITSFPNFIISQETNIGNVTAELELQRLQQEQLRRQEMVRRGQHGMYPGPPLGLLPLLEQMRPQPPQSNAMQTNQWPATAQLAQLTASARSPPPQDPDTPLNLSKQRSPSPAQPMMLPRFVPYPPMDESQYNMPKEEEYNAACNTSSWNQSPSEDAEKAKLVRQPRRDEAGKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKNLMRTRRQEMRQLWCRDGGSELGFLPPSLSSPGPSNSSPPPNGGNYMNPGFSPPLSPREDD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00000321; iTF_00018152; iTF_00001162; iTF_00017324; iTF_00171743; iTF_00186165; iTF_00185297; iTF_00772865; iTF_01463239; iTF_00680528; iTF_00010058; iTF_01464145; iTF_00009011; iTF_00622819; iTF_00071424; iTF_00124257; iTF_00952705; iTF_01192705; iTF_01533921; iTF_01340098; iTF_00111651; iTF_01534819; iTF_00041764; iTF_00123364; iTF_00040805; iTF_00375205; iTF_00449093; iTF_01062789; iTF_01063749; iTF_00809126; iTF_00810054; iTF_00036711; iTF_01029255; iTF_00038760; iTF_01085224; iTF_00771913; iTF_00850729; iTF_01030217; iTF_00037803; iTF_00301163; iTF_00711851; iTF_01094027; iTF_00300204; iTF_00726348; iTF_00973772; iTF_01064652; iTF_00172941; iTF_00831213; iTF_01533037; iTF_00758158; iTF_00951822; iTF_00302095; iTF_00364015; iTF_00445167; iTF_00851791; iTF_01230575; iTF_01527215; iTF_00274416; iTF_01117200; iTF_00122385; iTF_00120498; iTF_00685426; iTF_00928691; iTF_01439923; iTF_00446132; iTF_01027316; iTF_00745685; iTF_00147446; iTF_00273590; iTF_00121431; iTF_00177111; iTF_01061879; iTF_00667480; iTF_01119320; iTF_01441080; iTF_01526008; iTF_01028282; iTF_01338746; iTF_00374107; iTF_00425371; iTF_01026171; iTF_01094907; iTF_00042620; iTF_00447132; iTF_00907036; iTF_00907868; iTF_01031132; iTF_01118300; iTF_01246972; iTF_00888253; iTF_00906142; iTF_01093086; iTF_01084255; iTF_00043488; iTF_00677603; iTF_01332696; iTF_01075427; iTF_01245923; iTF_00112484; iTF_01312209; iTF_00113310; iTF_01317279; iTF_00859457; iTF_01358857; iTF_00858531; iTF_01429923; iTF_00819152; iTF_00290693; iTF_01569319; iTF_00187146; iTF_01547538; iTF_00787639; iTF_01018551; iTF_01017716; iTF_00448120; iTF_00636391; iTF_00908834; iTF_00723944; iTF_00323497; iTF_00785193; iTF_00783470; iTF_00049891; iTF_01342206; iTF_01538733; iTF_01285528; iTF_00146410; iTF_00720279; iTF_00683348; iTF_00681636; iTF_01334885; iTF_00682415; iTF_01217482; iTF_00164354; iTF_00405892; iTF_00933742; iTF_01178549; iTF_00403798; iTF_01248120; iTF_00934751; iTF_00856614; iTF_00206057; iTF_00206979; iTF_01335921; iTF_00288855; iTF_00663066; iTF_01182874; iTF_00119583; iTF_01219757; iTF_01509592; iTF_01076491; iTF_01264601; iTF_01361612; iTF_01010349; iTF_00282382; iTF_00281319; iTF_00968014; iTF_01197710; iTF_00889200; iTF_00276402; iTF_00450099; iTF_00960915; iTF_00347458; iTF_00076519; iTF_00075528; iTF_01081576; iTF_01281324; iTF_00776707; iTF_00775237; iTF_00777990; iTF_00780236; iTF_00781006; iTF_00781809; iTF_00779487; iTF_00744623; iTF_01133713; iTF_01502963; iTF_01333812; iTF_01331563; iTF_00409269; iTF_00878838; iTF_01503867; iTF_01080702; iTF_01079880; iTF_01078191; iTF_01078192; iTF_01220640; iTF_00411446; iTF_01260088; iTF_00063577; iTF_00383641; iTF_00736605; iTF_01341263; iTF_00279098; iTF_00007997; iTF_01564641; iTF_00026838; iTF_00027737; iTF_00654271; iTF_01072480; iTF_01282272; iTF_01279240;
- 90% Identity
- iTF_00049891;
- 80% Identity
- -