Basic Information

Transcription Factor Domain

TF Family: CSD
Domain: CSD domain
PFAM: PF00313
TF Group: Beta-Scaffold Factors
Description: In molecular biology, the cold-shock domain (CSD) is a protein domain of about 70 amino acids which has been found in prokaryotic and eukaryotic DNA-binding proteins. When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees Celsius, a 4–5 hour lag phase occurs, after which growth is resumed at a reduced rate.During the lag phase, the expression of around 13 proteins, which contain cold shock domains is increased 2–10 fold. These so-called 'cold shock' proteins are thought to help the cell to survive in temperatures lower than optimum growth temperature, by contrast with heat shock proteins, which help the cell to survive in temperatures greater than the optimum, possibly by condensation of the chromosome and organisation of the prokaryotic nucleoid.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 1.6e-14 1.1e-10 42.1 0.1 19 65 22 72 21 73 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	1.6e-14	1.1e-10	42.1	0.1	19	65	22	72	21	73	0.96

Coding Sequence: atgccacaagCTTTGTATGCCACGAAACGTGCAATAAATAAGGAAGGGCGGTGTCTGCGGTTCAGGAACGACACGAAGGAGGATGTGTTCGTCCATCAAACGGCGATCACGCGGAACAACCCGCGCAAGGCTGTGCGCTCGGTGGGCGACGGAGAGGCCGTAGAGTTTGCCGTGGTCGCCGGGGAGAAAGGCTTCGAGGCAGCTGGAGTCACCGGACCCGGCGGCGAGCCCGTCAAGGGCTCCCCGTATGCGGCCGACAAGCGACGCGGCTTCCCCCGCCAGTACTACCCTCGTCAGAGCGGAGGGCGCGGCGGTGAGGGCGCTCCACGCAGAGGCATGGGACGTCGCGGGCCCCCGGTCAACCAAGGGGGCGCGCAGGGTGATGAGGGGCAAGAAGGGGGAGCACAGCCACAACGGAGCTACTTCCGGCGCAACTTTCGTGGTGGGCGTCGCGGTAGTGGGCCTGGACCCATGAATCGCGGCGGCTTCCGTCGCGTCCGGCCGCGCAGCAGCTTCCAGGCCGGACCGGCTCGCGACGAAGCCGGCGCCTCGCAGTCTGACCAACCGAAGCCCAAGTCGAAGCCTCAGACCACGCTCGAAGCTGCCACCACCAACGAGAGCCAGGCATAG
Protein Sequence: MPQALYATKRAINKEGRCLRFRNDTKEDVFVHQTAITRNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGFPRQYYPRQSGGRGGEGAPRRGMGRRGPPVNQGGAQGDEGQEGGAQPQRSYFRRNFRGGRRGSGPGPMNRGGFRRVRPRSSFQAGPARDEAGASQSDQPKPKSKPQTTLEAATTNESQA

Sequence clustering based on sequence similarity using MMseqs2