Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0025 67 3.8 2.0 11 16 13 18 11 20 0.83

2 5 0.02 5.2e+02 1.0 0.2 12 15 33 36 32 43 0.89

3 5 5e-10 1.3e-05 25.2 1.9 6 21 55 70 51 71 0.86

4 5 0.13 3.4e+03 -1.6 4.6 10 15 84 89 83 90 0.83

5 5 1 2.6e+04 -5.3 1.3 6 9 94 97 93 97 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0025	67	3.8	2.0	11	16	13	18	11	20	0.83
2	5	0.02	5.2e+02	1.0	0.2	12	15	33	36	32	43	0.89
3	5	5e-10	1.3e-05	25.2	1.9	6	21	55	70	51	71	0.86
4	5	0.13	3.4e+03	-1.6	4.6	10	15	84	89	83	90	0.83
5	5	1	2.6e+04	-5.3	1.3	6	9	94	97	93	97	0.72

Coding Sequence: ATGTCTGATGACGGGTCAACTGTAGTTGAGAAGAAAGGACGTGGTAGGCCAAAATCCAATGGAACACAAtcaGAGGCGAAAGCAGATGCCAAAAAAAGAGGTAGACCACCAGCGGCATCGAAAGTGAAAGAATCCACAAAGTCCTCCGACGATGAGCAGGCGCCGATAGCAAAACGAGGGAGGGGCAGACCTAAAGGCTCCAAGAAAAAGGCGCCAGTTCCCCGAGCTAAGGCCGCAACGGGTGAGGGTCGGAGCCGCGGCCGGCCGCGCAAGGACGCTCCACCACCGAAGAAGGACGCCACCTCCGATGAGGAGCAGGACGACGAAGAAGAGGACGAGGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTVVEKKGRGRPKSNGTQSEAKADAKKRGRPPAASKVKESTKSSDDEQAPIAKRGRGRPKGSKKKAPVPRAKAATGEGRSRGRPRKDAPPPKKDATSDEEQDDEEEDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2