Tacr017702.1
Basic Information
- Insect
- Tachystola acroxantha
- Gene Symbol
- -
- Assembly
- GCA_963506565.1
- Location
- OY735889.1:5274262-5288327[-]
Transcription Factor Domain
- TF Family
- AF-4
- Domain
- AF-4 domain
- PFAM
- PF05110
- TF Group
- Unclassified Structure
- Description
- This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X syndrome) nuclear proteins. These proteins have been linked to human diseases such as acute lymphoblastic leukaemia and mental disabilities [1]. The family also contains a Drosophila AF4 protein homologue Lilliputian which contains an AT-hook domain. Lilliputian represents a novel pair-rule gene that acts in cytoskeleton regulation, segmentation and morphogenesis in Drosophila [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.8e-12 4.9e-08 33.2 0.0 3 81 49 129 46 144 0.83
Sequence Information
- Coding Sequence
- ATGTCTGATCTACGTCTGGTCGAAGAATATACcatcaattgtgtttggtcatgGTACGACAAGTGGAACCGGGACCGCGGCGGAGGCGCCGGCGGTGGGGGCGGCGGCGACTCCGGCGGCGCGTGGGCGGGCCGCGAGCGGGACCGCGACCGCGACCGCGAGCGCGAACGCGAGCGACAGGCTCGCGCGCACCAGATGTCGCAAGCGCACGCCGCCGAGCCAGACGCCTCCTCGCTATTCCCGGCGCCGTTCAGGGTGACAGGCAACAGGGACCGCGTGAGCCAGCAGATCCAGATCAAGCTCGGTGACTACCACCTGGCGCAGACGCTGCTGGACGACCCCAGCAAGTCCATCGGCATCTGCGCTGAACCACCGAGCCCCGCGCCGTGGTTGGATTGTACCGCTTCTGTGCACCGCAATATTCAAGAGACGCCGTAG
- Protein Sequence
- MSDLRLVEEYTINCVWSWYDKWNRDRGGGAGGGGGGDSGGAWAGRERDRDRDRERERERQARAHQMSQAHAAEPDASSLFPAPFRVTGNRDRVSQQIQIKLGDYHLAQTLLDDPSKSIGICAEPPSPAPWLDCTASVHRNIQETP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00026862; iTF_00027763;
- 90% Identity
- -
- 80% Identity
- -