Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 10 5.4e+03 -0.9 0.0 44 74 65 94 54 123 0.69

2 3 4e-23 2.2e-20 74.4 0.1 4 106 160 256 158 259 0.90

3 3 1.6 8.6e+02 1.7 0.0 77 109 259 291 256 292 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	10	5.4e+03	-0.9	0.0	44	74	65	94	54	123	0.69
2	3	4e-23	2.2e-20	74.4	0.1	4	106	160	256	158	259	0.90
3	3	1.6	8.6e+02	1.7	0.0	77	109	259	291	256	292	0.86

Coding Sequence: atgagtgCAACAAATACGAAAATATTCGATGAAAGTCATACTCGACGAGTGGAAAAAGAGTTCACTTACAAATGGTTAATTGAAGATTTTCAATGCAGCAAAGTGCGGAATGAAGAAACTCTacctttcaaaaattttcaatttaacttTGGTGCAGAAGCAAAATTTTGCGGAAAATTATACTTGCAAGGTGATGAATGTAAGAAAAGAGAATGTTGTCTAGAATTGCAAAGCACAAATTTAAACAACTTGAGAGCTTTAGTTTGCTTTTATGTTGGTAACTCCACAAATGACAACCAGATCCTTGAGATTGTGAATAAAGATTCTTACAAACTATGCTGGCAGCTCTTCAAAGAATCGGAATGTCTTTTAACAAAATACCTAAAGGATAACATTGTTACCATAACCTGCATAATATCGTACGTAACTTATGAAGAACAAATAATTTCAAGCTATTCAAAAATTGATGCTATTGAgctttataaaactaaaatgaatTGGGATGTAACGTTCGTTGTGAGAGGACATGAATTACAGGGTCACAGATCCATATTAGCAGATCGCAGCAATGTCTTTGCCACCATGTTTGAACAGGAAATGAATAAAttgaataacacaataattattaatgatGTTAGTGTGGAAGTGTTGCAGGAGATGCTACGCTATCTGTACACTGGAGAAGTGGTTAAAATAACATTGGAACTGTTAGCGGCCAGCGTTAAATACGATTTGCCGCAGTTAAAAACTATTTGTGAAAATGACCTGATGCTTAGAATAACAAATGAAAGTGCAGCAGAATCATTGGTGATTGCTAATACGTACGATgtggcaaaactaaaaaagcatgCCATCGTTTATATTAAGGACAATCTGGCAGCTGTAATAGAAACTGCAGGCTGGTATAAATATGTCAAAAATTATCATTGTTTATTTGCCGAAATTTGGAAATAA
Protein Sequence: MSATNTKIFDESHTRRVEKEFTYKWLIEDFQCSKVRNEETLPFKNFQFNFGAEAKFCGKLYLQGDECKKRECCLELQSTNLNNLRALVCFYVGNSTNDNQILEIVNKDSYKLCWQLFKESECLLTKYLKDNIVTITCIISYVTYEEQIISSYSKIDAIELYKTKMNWDVTFVVRGHELQGHRSILADRSNVFATMFEQEMNKLNNTIIINDVSVEVLQEMLRYLYTGEVVKITLELLAASVKYDLPQLKTICENDLMLRITNESAAESLVIANTYDVAKLKKHAIVYIKDNLAAVIETAGWYKYVKNYHCLFAEIWK

Sequence clustering based on sequence similarity using MMseqs2