Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.00033 4.2 8.6 0.4 17 48 83 113 71 117 0.78

2 4 1.2e-05 0.15 13.2 0.0 21 52 114 145 109 146 0.88

3 4 0.0024 31 5.8 0.0 21 51 142 172 140 173 0.87

4 4 9.8e-05 1.2 10.3 0.1 21 47 170 196 168 201 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.00033	4.2	8.6	0.4	17	48	83	113	71	117	0.78
2	4	1.2e-05	0.15	13.2	0.0	21	52	114	145	109	146	0.88
3	4	0.0024	31	5.8	0.0	21	51	142	172	140	173	0.87
4	4	9.8e-05	1.2	10.3	0.1	21	47	170	196	168	201	0.89

Coding Sequence: ATGACTAATTGTGAAATTGTTATCGTTGCAACAACTGATGAACCAGCGACGGACATACAAATCCCCTTCAACGTGATAACCTCGGCGGCAACAGTTTCAGCAACTGGCGTCACCACTACGACTCATCACCTCGCGCCACTGCAACAAAGCTCGGAACAGCAAGTCCTGCAGCTGCAAACCGAAGACATCCAGCAGCAAGTGGAAACGGCGGCGGGAACATTACCGCCGCATTTGGATCGTTATCCAGCCAATAGTCAGGAGAAGCCATTCCAATGCAGCATTTGTGAGCGACGGTTTCGACAGCTAAGCACACTAACGAATCATGTTAAAATCCATACCGGCGAAAAACCCTACAAATGCACGATATGCGACAAAACTTTTCGACAATCGAGCACCCTCACGAATCACATGAAAATCCACACGGGCGAAAAACCTTTCATTTGTTCGTTCTGTCCCAAGCAGTTCCGCCAACTGAGCACGCTAACAAATCATCTAAAAATTCACACCGGCGAGAAACCATTCGAATGTGCCGTTTGCAAAAAACAATTCCGCCAATCGAGTACGCTCAACAATCACATAAAAATCCACGTAATGGACAAGGTGTATATACCCGTGAAAATCAAAACCGAGGAGGAAGAAGGATGA
Protein Sequence: MTNCEIVIVATTDEPATDIQIPFNVITSAATVSATGVTTTTHHLAPLQQSSEQQVLQLQTEDIQQQVETAAGTLPPHLDRYPANSQEKPFQCSICERRFRQLSTLTNHVKIHTGEKPYKCTICDKTFRQSSTLTNHMKIHTGEKPFICSFCPKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVYIPVKIKTEEEEG

Sequence clustering based on sequence similarity using MMseqs2