Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 4.3 1.2e+03 -0.0 0.1 4 21 58 74 55 79 0.77

2 4 5.7 1.5e+03 -0.4 0.1 65 79 117 131 111 146 0.78

3 4 2.1e-20 5.6e-18 65.4 0.1 2 109 158 263 157 264 0.92

4 4 0.22 58 4.2 0.2 81 107 267 293 262 296 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	4.3	1.2e+03	-0.0	0.1	4	21	58	74	55	79	0.77
2	4	5.7	1.5e+03	-0.4	0.1	65	79	117	131	111	146	0.78
3	4	2.1e-20	5.6e-18	65.4	0.1	2	109	158	263	157	264	0.92
4	4	0.22	58	4.2	0.2	81	107	267	293	262	296	0.89

Coding Sequence: ATGTTCAGGATACCCTACGTGATATCCAAAAATGGAGACACTGTGTCTAATTTGATAACTTGGGAGATTCCCAAGTTTAGTGACGTTATAAAGAAGGGGCAAGAGCTTCGCGCAGAATGTACCAACCGAGACAATTTGGACGATTACAATTTTCAATTAAAATTGGAAGTTCTTGACAGAAATAAAAAAATGGTCGATGTATTTTTTCTCTGCCGTAACAAAGTCTACCTGAAATCTGTAGAATGGATAAATCCAAAATTCAATGATGATAACCAAAGTAAATGTAAGGATTATATGCAGTGCATCATACAACCGTACAAATGGTATCTTTTGAACTCTTGCCCAATTGACAGTATTCTTAAGTATCTATACAAGGATTTATTAAGCATAGAATTGAAATTTACAATGATTGATTATACCGAAACAGATAAAAATATCATTGTGCCAGAGTCTGAGATGCACAATGATTTTGGTAATTTACTTCGTCGCGGTTCTTTTTCTGATGCTATAATGAAATCTGTTGATGGCGAAGAATATAAGATCCATAAAGCTTTCGTGACGAGCCGAAGCGTTGTGTTGAAAGCTCATTTTGAACACAACACAACAGAAAGCCAAACAAATGTAATATTGTCACCATTTGACTCAGCTGTGCTTAATGAAGTATTAAATTTCATATATACGGACCGTGCTCCAAAAGTTGATGACATGCCGGAGAAATTGTTAGCTGCCGCTGACTTTTATCAACTCAACAAACTTAAAGGTCTCGCTGAGGAGGCTCTATACAGGAAATTAACGGTGGAAAATGCCATGGAGTACTTAGAATTAGCTGATTTGCATTCCTGTAAGCAATTGAAGGAAACTATCCAGGAATTTATTAAAGATGGTCGCAGTAAAGCAACAGTTCAGACAGAAGGCTGGGCCAACATGAAGTCACTTGAACTAATTAAGGGACTTATGGAATGTATTATTTTAAGTGAAAAATAA
Protein Sequence: MFRIPYVISKNGDTVSNLITWEIPKFSDVIKKGQELRAECTNRDNLDDYNFQLKLEVLDRNKKMVDVFFLCRNKVYLKSVEWINPKFNDDNQSKCKDYMQCIIQPYKWYLLNSCPIDSILKYLYKDLLSIELKFTMIDYTETDKNIIVPESEMHNDFGNLLRRGSFSDAIMKSVDGEEYKIHKAFVTSRSVVLKAHFEHNTTESQTNVILSPFDSAVLNEVLNFIYTDRAPKVDDMPEKLLAAADFYQLNKLKGLAEEALYRKLTVENAMEYLELADLHSCKQLKETIQEFIKDGRSKATVQTEGWANMKSLELIKGLMECIILSEK

Sequence clustering based on sequence similarity using MMseqs2