Sand006894.1
Basic Information
- Insect
- Synanthedon andrenaeformis
- Gene Symbol
- -
- Assembly
- GCA_936447275.2
- Location
- CAKZFQ020000377.1:70659-71438[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.0013 5.1 7.7 0.0 22 52 31 61 22 62 0.87 2 6 0.0017 6.8 7.3 0.1 22 49 98 125 85 130 0.84 3 6 0.0017 6.6 7.3 0.0 24 49 131 156 127 158 0.92 4 6 0.00011 0.45 11.1 0.0 24 50 161 187 159 191 0.91 5 6 0.0013 4.9 7.7 0.0 24 48 192 216 189 221 0.89 6 6 0.018 70 4.0 0.0 23 48 221 246 215 250 0.86
Sequence Information
- Coding Sequence
- ATGACGCACTTTAGACATCGCTGTGAAGTATGCAATAGATGTTATCAGAGCAAAGGTGGATTGCGTAGCCACGAAATTGTGCATAAGGATGAGAGAAAGTTTAAGTGCTCAATATGTAATAATGGGTTTACACTGAGCAGAAGTTTGAAGGCTCACATGGAAACACACAAGGACGGAAAACCGCACGAGCACCGCAATAGACAAATGTTGACGCATGCTGAGTTAAAAGAGCGCGACAAGAAGACATTTAAATCCAAGGACAAGCACATGTCGACTGTACATTCGGGCCTTAAGCCACCCACTCAGTGTGACATTTGCAAAAAGACATATAAATCCAAAAAGATTATACGCAGGCACATGATGGCTGTACATTTGGGCCTTAAGCCAACGCCCACTGAGTGCAACATTTGCAAGAAGACATTTAAATACAAACATAATTTAAGCAAGCACATGTCTGTTGTACATTTGGGCCTTTTGCCACCCACTCAGTGCGAAATTTGCAAGAAGACATTTAAATACAAGCGAGGTCTACGCAGCCACATGTCGGCTGAACATTTCGGCCTTAAGCCGACGCCCGCTGAGTGCTCAATTTGCAATAAGACATTTAAACACAAAGAGAGTTTAAACAGGCACATGTCGGCTCTACATTCGGGTCTTAAGCCACCCGCTGAGTGCGACATGTGCAAGAAGACATTTAAACACAAACACAGTTTAAGCAGGCATAAGTCGACTGTACATTTGGGCTTGAAGCAAACACGCACCAAAAGAAAAGTTATTTAA
- Protein Sequence
- MTHFRHRCEVCNRCYQSKGGLRSHEIVHKDERKFKCSICNNGFTLSRSLKAHMETHKDGKPHEHRNRQMLTHAELKERDKKTFKSKDKHMSTVHSGLKPPTQCDICKKTYKSKKIIRRHMMAVHLGLKPTPTECNICKKTFKYKHNLSKHMSVVHLGLLPPTQCEICKKTFKYKRGLRSHMSAEHFGLKPTPAECSICNKTFKHKESLNRHMSALHSGLKPPAECDMCKKTFKHKHSLSRHKSTVHLGLKQTRTKRKVI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01386130;
- 90% Identity
- iTF_01386130;
- 80% Identity
- iTF_01386130;