Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 3.2e-38 6e-35 120.4 0.2 1 86 68 152 68 154 0.96

2 2 6.2 1.2e+04 -2.3 0.1 11 31 221 241 214 242 0.73

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	3.2e-38	6e-35	120.4	0.2	1	86	68	152	68	154	0.96
2	2	6.2	1.2e+04	-2.3	0.1	11	31	221	241	214	242	0.73

Coding Sequence: ATGGCTTCAGTGCAAGTTATTCTACCATCAATAAAACTGGAGAAAGCGCTTGAAAAATCGTTGCTTGAAAATGAAGTtTCAATTCTCGGCGATCACAGTAACTCCCAAACTAcggaagaaaatcaattttcatcgTCGGAATTATCGGAATCGTACAGCGAGCCATCAAGTTCACCGGATAGTATGGAAGATTGCGATCCAGAACGTCCCCAATTCACTTACGATTCATTGATAATGATGGCCATCAAAGCGAGTCCTAAACAACGATTAACATTATCGGAAATCTACACTTACATCACGGACAATTTTCCATACTATCGAACGTGCAAAACACAATGGCAAAACTCCATTCGTCACAATTTAAGTGTGAACAAGTGTTTTGTGAAAATCCCTCGTGAATATGGAAATCCAGGACGTGGAAATTATTGGGGCCTATCGGCGAATGCCGAAGACATGTACATTGGTGGAGATACCGGAAAACTGCGACAAATGCCTTACCAGCAACCACAGAATCTATCGCAGGCAAATTATTATAATCCTGCGTCACCGGCCATGCAAGGAGTGGCATATCAATGTGGAAATTGCGGAAATGTTGGTTGTATGTGCTATCAAGCGATTGGACTTCAATATCAAGTGACTCAAATACCGCATCAATATCTTCATATGCAGCAAATGCAAAAATTGCCACCgatgcaaatgcaaatgcatCAGATCAGCAACTTTACATTTTAg
Protein Sequence: MASVQVILPSIKLEKALEKSLLENEVSILGDHSNSQTTEENQFSSSELSESYSEPSSSPDSMEDCDPERPQFTYDSLIMMAIKASPKQRLTLSEIYTYITDNFPYYRTCKTQWQNSIRHNLSVNKCFVKIPREYGNPGRGNYWGLSANAEDMYIGGDTGKLRQMPYQQPQNLSQANYYNPASPAMQGVAYQCGNCGNVGCMCYQAIGLQYQVTQIPHQYLHMQQMQKLPPMQMQMHQISNFTF

Sequence clustering based on sequence similarity using MMseqs2