Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 6.4e-05 0.23 12.1 0.0 26 52 27 53 9 54 0.91

2 5 3.2e-06 0.012 16.3 0.1 12 46 50 81 49 86 0.82

3 5 0.0066 24 5.6 0.4 23 48 88 113 83 118 0.89

4 5 0.58 2.1e+03 -0.6 0.1 39 48 127 136 115 141 0.67

5 5 0.94 3.5e+03 -1.3 0.2 27 47 149 169 147 174 0.75

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	6.4e-05	0.23	12.1	0.0	26	52	27	53	9	54	0.91
2	5	3.2e-06	0.012	16.3	0.1	12	46	50	81	49	86	0.82
3	5	0.0066	24	5.6	0.4	23	48	88	113	83	118	0.89
4	5	0.58	2.1e+03	-0.6	0.1	39	48	127	136	115	141	0.67
5	5	0.94	3.5e+03	-1.3	0.2	27	47	149	169	147	174	0.75

Coding Sequence: ATGAATTCATCCCCCAAATTTCCCAGCAAAAGTAAACTCACCAGCCACCTGCCCGTTCATAGCACCATCTGTACTTGTATGTGCGATATTTGTGGTTCTACATTTAAAACTAAATTTACCCTTAAAAAACACTTGGAATTAAAACACACCGAAAATCCACGTAAGGACAAGGAACCCCAACAATGTCCCGTCTGTTATAAGGTGCTGATTGGCCATAAGGGTCTTAGGGCACACATGAGCAATATACATAACGATGATGGACAGGAGCATCGTTGTAAAATTTGTAATCATGTCTCAACGACGGCCAAAGGCTTACGGGTACATGAGATCTTCCGTCATGAAAAGCAGAGAAAACACAAGTGTAATTTCTGTGATAAGGCCTTTAAACGACCGTTGGAATTGAGAGAACACGTTGCCACCCATACCGGCATGTCTTTGTACCAATGTGCCGAATGCAATGCAACCTTTAAGTCAAACTCAAATTATTATCATCACGTAAGACGTTTTCATAAGGGAAAATCAAGAAAGGAGTTATTGATTAAAATGGATGAAGGTCTTAATGTATAA
Protein Sequence: MNSSPKFPSKSKLTSHLPVHSTICTCMCDICGSTFKTKFTLKKHLELKHTENPRKDKEPQQCPVCYKVLIGHKGLRAHMSNIHNDDGQEHRCKICNHVSTTAKGLRVHEIFRHEKQRKHKCNFCDKAFKRPLELREHVATHTGMSLYQCAECNATFKSNSNYYHHVRRFHKGKSRKELLIKMDEGLNV

Sequence clustering based on sequence similarity using MMseqs2