Ssim004994.1
Basic Information
- Insect
- Spicauda simplicius
- Gene Symbol
- DMRT2
- Assembly
- GCA_949699795.1
- Location
- OX453058.1:9280533-9288937[+]
Transcription Factor Domain
- TF Family
- DM
- Domain
- DM domain
- PFAM
- PF00751
- TF Group
- Zinc-Coordinating Group
- Description
- The DM domain is named after dsx and mab-3 [2]. dsx contains a single amino-terminal DM domain, whereas mab-3 contains two amino-terminal domains. The DM domain has a pattern of conserved zinc chelating residues C2H2C4 [1]. The dsx DM domain has been shown to dimerise and bind palindromic DNA [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.9e-26 2.4e-22 79.3 11.4 1 47 18 64 18 64 0.99
Sequence Information
- Coding Sequence
- ATGCAAAGTGAGAGTAAGTGCAACACGGAGGCAGGTGGTCGGAAGGCGCTGCGGACGCCGAAGTGCGCGCGATGCCGCAACCACGGCGTCATCTCCTGCCTCAAGGGGCACAAGCGCCTCTGCCGCTGGCGCGACTGCCGCTGCCCCGGCTGTCTGCTGGTCCTCGAGAGGCAGCGCGTTATGGCCGCTCAGGTGGCCCTCCGTCGGCAGCAGGGCGCGGCGCGCGACGGCgaggcggcggcgctggcggcgcgcaAGCGAGCGTACCGCGCGCGGCTGCGCTGCGTGCAGATGTCGCGCGCCTTCCCCGTGCCCGTGCAGCCGCACTATGGCAACATAAGTCTCCTGAGCAACGATCCTGTATGGAGCGAAAGGGTGCGCCGACGGCGAGCCTTCGCGGACGCTGCGCTGGAGCGGGGAGCGCCGCCCGCCCCCGCGCTGCCTTCCCCGCCGGCCCTGCCCgcccccgcgccgcccgcccccgCTGACGCCCTGTGCCGCCACCTCCTAGCGGCGCTGCTCTCTAACTACGCACCACCCCCGCAACCGGCGAGACCGAAGATATCCTTCTCTATAGAATCCATAATTGGTGTACAGTGA
- Protein Sequence
- MQSESKCNTEAGGRKALRTPKCARCRNHGVISCLKGHKRLCRWRDCRCPGCLLVLERQRVMAAQVALRRQQGAARDGEAAALAARKRAYRARLRCVQMSRAFPVPVQPHYGNISLLSNDPVWSERVRRRRAFADAALERGAPPAPALPSPPALPAPAPPAPADALCRHLLAALLSNYAPPPQPARPKISFSIESIIGVQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00288096;
- 90% Identity
- -
- 80% Identity
- -