Sfug009868.1
Basic Information
- Insect
- Solenopsis fugax
- Gene Symbol
- Lrrfip2
- Assembly
- GCA_003595255.1
- Location
- QKQZ01014971.1:1-1602[+]
Transcription Factor Domain
- TF Family
- LRRFIP
- Domain
- LRRFIP domain
- PFAM
- PF09738
- TF Group
- Unclassified Structure
- Description
- LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'- AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA [1]. LRRFIP2 may function as activator of the canonical Wnt signalling pathway, in association with DVL3, upstream of CTNNB1/beta-catenin [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.3e-25 2.2e-21 77.3 4.4 223 300 1 74 1 74 0.98 2 2 0.012 1.9e+02 2.0 0.9 122 161 74 113 72 114 0.84
Sequence Information
- Coding Sequence
- attcgGTTGAGAAAATTTGCTTCTGAAAAAAAGGACTTGCAAGATGAAATTCGCCACTTAAAATTGGAATTAGAAGAAACTAGGAATCGTATGAGACCCGAAAAATCATCTGGTTCAATATTagGTTGTTTATCGGACAATGAAGATATTCAACGTgaagcaaataaattattggctgattataagtttaaattacaaaaagcgGAGCAAGATATGTCTACACTGCAAGCAACAGTAGCTAGATTAGAAAGTCAAGTAATTCGTTATAAATCAGCTGCAGAAGCATCTGAAAAAGCAGAAGATGAgctaaaagtagaaaaaagaaagttacAAAGAGAAGTAtga
- Protein Sequence
- IRLRKFASEKKDLQDEIRHLKLELEETRNRMRPEKSSGSILGCLSDNEDIQREANKLLADYKFKLQKAEQDMSTLQATVARLESQVIRYKSAAEASEKAEDELKVEKRKLQREV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -