Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 2.3 3.3e+03 -1.5 0.0 39 45 16 22 14 29 0.75

2 6 3e-05 0.043 14.2 0.1 22 46 27 51 22 59 0.84

3 6 2.6 3.7e+03 -1.6 0.0 39 45 61 67 60 74 0.75

4 6 3.1e-05 0.043 14.2 0.1 22 46 72 96 67 104 0.84

5 6 2.1 3e+03 -1.3 0.0 39 46 106 113 105 121 0.72

6 6 1.9 2.6e+03 -1.2 0.0 22 44 117 139 113 142 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	2.3	3.3e+03	-1.5	0.0	39	45	16	22	14	29	0.75
2	6	3e-05	0.043	14.2	0.1	22	46	27	51	22	59	0.84
3	6	2.6	3.7e+03	-1.6	0.0	39	45	61	67	60	74	0.75
4	6	3.1e-05	0.043	14.2	0.1	22	46	72	96	67	104	0.84
5	6	2.1	3e+03	-1.3	0.0	39	46	106	113	105	121	0.72
6	6	1.9	2.6e+03	-1.2	0.0	22	44	117	139	113	142	0.80

Coding Sequence: NNNNNNCATATCATGACACACACAGGGGACAAACCTTACATATGTAATTTGAAGAGACATATCATGACACACACAGGGGACAAACCTTACATATGTCAGTTTTGTGATTTTAAGACCACTCAATCACGTAATTTGAAGAGACATATCATGACACACACAGGGGACAAACCTTACATATGTAATTTGAAGAGACATATCATGACACACACAGGGGACAAACCTTACATATGTCAGTTTTGTGATTTTAAGACCACTCAATCACGTAATTTGAAGAGACATATCATGACACACACAGGGGACAAACCTTACATATGTAATTTGAAGAGACATATCATGACACACACAGGGGACAAACCTTACATATGTGAGTTTTGTGATTTTAAGACTACTAATTCAAGTACTTTGAAGACACATGTCATGACACACAGGGGACAAACCTCACATATGTGA
Protein Sequence: XXHIMTHTGDKPYICNLKRHIMTHTGDKPYICQFCDFKTTQSRNLKRHIMTHTGDKPYICNLKRHIMTHTGDKPYICQFCDFKTTQSRNLKRHIMTHTGDKPYICNLKRHIMTHTGDKPYICEFCDFKTTNSSTLKTHVMTHRGQTSHM

Sequence clustering based on sequence similarity using MMseqs2