Basic Information

Insect: Sitophilus oryzae
Gene Symbol: -
Assembly: GCA_002938485.2
Location: NW:579277-581403[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.00058 0.03 14.5 6.0 1 23 9 32 9 32 0.98

2 10 0.0005 0.026 14.7 2.2 2 23 39 60 38 60 0.95

3 10 2.5e-05 0.0013 18.8 1.7 1 23 67 89 67 89 0.99

4 10 0.00056 0.029 14.5 0.6 2 23 96 118 95 118 0.96

5 10 2.2e-05 0.0012 18.9 2.3 1 23 124 146 124 146 0.98

6 10 0.0032 0.17 12.1 1.1 2 23 157 179 156 179 0.96

7 10 5.3e-06 0.00027 20.9 0.3 1 23 185 207 185 207 0.98

8 10 4.9e-05 0.0025 17.9 1.0 1 23 213 235 213 235 0.97

9 10 7.7e-08 4e-06 26.7 2.1 1 23 241 263 241 263 0.98

10 10 2.4e-06 0.00013 22.0 0.6 1 23 269 292 269 292 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.00058	0.03	14.5	6.0	1	23	9	32	9	32	0.98
2	10	0.0005	0.026	14.7	2.2	2	23	39	60	38	60	0.95
3	10	2.5e-05	0.0013	18.8	1.7	1	23	67	89	67	89	0.99
4	10	0.00056	0.029	14.5	0.6	2	23	96	118	95	118	0.96
5	10	2.2e-05	0.0012	18.9	2.3	1	23	124	146	124	146	0.98
6	10	0.0032	0.17	12.1	1.1	2	23	157	179	156	179	0.96
7	10	5.3e-06	0.00027	20.9	0.3	1	23	185	207	185	207	0.98
8	10	4.9e-05	0.0025	17.9	1.0	1	23	213	235	213	235	0.97
9	10	7.7e-08	4e-06	26.7	2.1	1	23	241	263	241	263	0.98
10	10	2.4e-06	0.00013	22.0	0.6	1	23	269	292	269	292	0.96

Sequence Information

Coding Sequence: ATGAAATTAGAAATAGAAGAATGCTATACATGCGACTATTGCCATGAAAGTTTTCCAAAGGAGCATAGACTCACGTATCACTTAAAGACGAAACACAAAGAGGTTCCTAGACTGTCGTGCAACTTATGCAAGAAAACTTTCAAGACCAGACAAAAACTGGACCTGCATTCGATCACTCACGATATTAAACGCGAAAACTACCAGTGCGAAACCTGTAAAAAGACTTTAAAATCGAAACAAGCCCTCATCGTGCACACTAAAAGACACCTAGAACTTTACTCGGTGAAGTGTGAGTTTTGCGATAAAGGTTTCTTTGGAATATCCAGTTTAAAGTTGCACTTAAACTCAAAACACATGggaaaaagtaaatttatttgcGACATATGCAACCGACCTTGTTATGATAGGACATCGTTAAAAAATCACATGCTCAAGCACTCCTCCGATTACAAGGTTCGAACCAAGGTGAAATGTAAAGAGTGCGATCGCGAATTTCTCGACGAGAAATACCTGAAAATTCACGAGAAGAAAAAGCACATTTCCGATAACAGGTTCATCTGTGACCTGTGCGGAAAGAAACTTTACTCGAAAAGCGGACTCAACGATCACATGAACGTCCACGAGGGACTCAAACCTCACATATGTGGGGTCTGCGGAACCGGTTTTGCCAACTCAACCACGTTAAGACTTCATTTTCGAAGACACACTGGGGAACGGCCTTACAGATGTACGATTTGTGATAAGGCTTTCACTCAGAGTCACAGTCTTAAGGTACACGTGAGACTTCACACCGGCGAAAAACCTTATACTTGCAGTATTTGTGGAAAATCGTTTGTTAGTACTAGCGTAATGAAATCTCATATGAAAGGGAATCATAAATTGAATTAA
Protein Sequence: MKLEIEECYTCDYCHESFPKEHRLTYHLKTKHKEVPRLSCNLCKKTFKTRQKLDLHSITHDIKRENYQCETCKKTLKSKQALIVHTKRHLELYSVKCEFCDKGFFGISSLKLHLNSKHMGKSKFICDICNRPCYDRTSLKNHMLKHSSDYKVRTKVKCKECDREFLDEKYLKIHEKKKHISDNRFICDLCGKKLYSKSGLNDHMNVHEGLKPHICGVCGTGFANSTTLRLHFRRHTGERPYRCTICDKAFTQSHSLKVHVRLHTGEKPYTCSICGKSFVSTSVMKSHMKGNHKLN

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01351966;
90% Identity: iTF_01351966;
80% Identity: iTF_01351966;