Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0014 0.52 10.1 2.8 17 44 9 33 3 33 0.90

2 10 0.075 28 4.5 0.9 18 29 39 50 37 63 0.79

3 10 0.017 6.5 6.5 2.6 10 37 60 88 55 92 0.74

4 10 0.00065 0.24 11.1 0.5 14 43 92 118 84 119 0.90

5 10 2.8 1e+03 -0.5 0.9 15 24 122 131 120 145 0.72

6 10 0.17 64 3.4 2.6 4 26 140 165 137 179 0.86

7 10 0.0036 1.3 8.7 0.9 12 39 180 204 169 208 0.79

8 10 0.56 2.1e+02 1.7 0.5 18 41 214 234 211 236 0.80

9 10 0.027 10 5.9 1.3 6 31 231 255 230 261 0.80

10 10 4e-05 0.015 15.0 1.4 6 44 259 293 255 293 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0014	0.52	10.1	2.8	17	44	9	33	3	33	0.90
2	10	0.075	28	4.5	0.9	18	29	39	50	37	63	0.79
3	10	0.017	6.5	6.5	2.6	10	37	60	88	55	92	0.74
4	10	0.00065	0.24	11.1	0.5	14	43	92	118	84	119	0.90
5	10	2.8	1e+03	-0.5	0.9	15	24	122	131	120	145	0.72
6	10	0.17	64	3.4	2.6	4	26	140	165	137	179	0.86
7	10	0.0036	1.3	8.7	0.9	12	39	180	204	169	208	0.79
8	10	0.56	2.1e+02	1.7	0.5	18	41	214	234	211	236	0.80
9	10	0.027	10	5.9	1.3	6	31	231	255	230	261	0.80
10	10	4e-05	0.015	15.0	1.4	6	44	259	293	255	293	0.84

Coding Sequence: ATGAAATTAGAAATAGAAGAATGCTATACATGCGACTATTGCCATGAAAGTTTTCCAAAGGAGCATAGACTCACGTATCACTTAAAGACGAAACACAAAGAGGTTCCTAGACTGTCGTGCAACTTATGCAAGAAAACTTTCAAGACCAGACAAAAACTGGACCTGCATTCGATCACTCACGATATTAAACGCGAAAACTACCAGTGCGAAACCTGTAAAAAGACTTTAAAATCGAAACAAGCCCTCATCGTGCACACTAAAAGACACCTAGAACTTTACTCGGTGAAGTGTGAGTTTTGCGATAAAGGTTTCTTTGGAATATCCAGTTTAAAGTTGCACTTAAACTCAAAACACATGggaaaaagtaaatttatttgcGACATATGCAACCGACCTTGTTATGATAGGACATCGTTAAAAAATCACATGCTCAAGCACTCCTCCGATTACAAGGTTCGAACCAAGGTGAAATGTAAAGAGTGCGATCGCGAATTTCTCGACGAGAAATACCTGAAAATTCACGAGAAGAAAAAGCACATTTCCGATAACAGGTTCATCTGTGACCTGTGCGGAAAGAAACTTTACTCGAAAAGCGGACTCAACGATCACATGAACGTCCACGAGGGACTCAAACCTCACATATGTGGGGTCTGCGGAACCGGTTTTGCCAACTCAACCACGTTAAGACTTCATTTTCGAAGACACACTGGGGAACGGCCTTACAGATGTACGATTTGTGATAAGGCTTTCACTCAGAGTCACAGTCTTAAGGTACACGTGAGACTTCACACCGGCGAAAAACCTTATACTTGCAGTATTTGTGGAAAATCGTTTGTTAGTACTAGCGTAATGAAATCTCATATGAAAGGGAATCATAAATTGAATTAA
Protein Sequence: MKLEIEECYTCDYCHESFPKEHRLTYHLKTKHKEVPRLSCNLCKKTFKTRQKLDLHSITHDIKRENYQCETCKKTLKSKQALIVHTKRHLELYSVKCEFCDKGFFGISSLKLHLNSKHMGKSKFICDICNRPCYDRTSLKNHMLKHSSDYKVRTKVKCKECDREFLDEKYLKIHEKKKHISDNRFICDLCGKKLYSKSGLNDHMNVHEGLKPHICGVCGTGFANSTTLRLHFRRHTGERPYRCTICDKAFTQSHSLKVHVRLHTGEKPYTCSICGKSFVSTSVMKSHMKGNHKLN

Sequence clustering based on sequence similarity using MMseqs2