Suni016887.1
Basic Information
- Insect
- Silvanus unidentatus
- Gene Symbol
- -
- Assembly
- GCA_963930825.1
- Location
- OZ005762.1:12222962-12223776[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.041 1.7e+02 2.6 0.1 26 38 100 112 91 128 0.70 2 5 0.012 50 4.3 0.1 22 45 126 149 119 156 0.83 3 5 0.00039 1.6 9.1 0.1 22 45 154 177 148 180 0.89 4 5 2.8e-05 0.12 12.7 0.1 21 52 181 212 177 212 0.88 5 5 0.0022 9.1 6.7 0.0 21 48 209 236 207 239 0.89
Sequence Information
- Coding Sequence
- ATGGAGGATAACAGGGACTTCCACTCATGTTTGGAACCGGTGGTTACAATAAACGACACATTCGGCCATCCACCACAAACCGACTTGAAATCCGACATCTTCACAAAGGAAATGCAAGGCGCCAGCACGAAAAAGCGAAAAAACGCCAAACTCCGTTACGATCGCGAATATTCCCCAACAAAAGACGACAAGAAAGTCATTACTCGTACACCACGCTCTCAAATCCGTTTGGTAACCAAAGCGGAAGCGATTTCAGCCGAGGAAACATATCAGAAACGTAAATCGTTGCCATTAGAAAAatgtccaatatgtaaaaaGTTTTTCCGACGCATGAAAACGCATTTATTGAAACACGATTTGAATTCACGGAATTTAAACGATCCATTAACGTGTTCGGTGTGTGCGAAAACGTTCAACACGCCCAGCAATCTCCAAATTCACATGCGAACACATACCGGCGACAAGCCGTACATTTGTGACATTTGTAATAAAGGATTCGCACAAAGTTGCAATCTAACCAACCATTTACGCACACATACAGGTGAAAAACCGTTTAAATGTCCACATTGTGATCGCGCCTTTACACAATCGGGCAATTTAAACAATCATATACGATTGCATACGGATGAGAAGCCGTTTAAATGTCACTTTTGTGACAAAGCTTTCGTCCAATCGGGAAATTTAAATTCGCATATTAGAAACAATCATAAATTTATTGAGGACAATTTGGCTAATGAATTGGTCGAGAAAATGGTGGCGTAA
- Protein Sequence
- MEDNRDFHSCLEPVVTINDTFGHPPQTDLKSDIFTKEMQGASTKKRKNAKLRYDREYSPTKDDKKVITRTPRSQIRLVTKAEAISAEETYQKRKSLPLEKCPICKKFFRRMKTHLLKHDLNSRNLNDPLTCSVCAKTFNTPSNLQIHMRTHTGDKPYICDICNKGFAQSCNLTNHLRTHTGEKPFKCPHCDRAFTQSGNLNNHIRLHTDEKPFKCHFCDKAFVQSGNLNSHIRNNHKFIEDNLANELVEKMVA
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01345220; iTF_01121951;
- 90% Identity
- iTF_01345220;
- 80% Identity
- iTF_01345220;