Scos038822.1
Basic Information
- Insect
- Scrobipalpa costella
- Gene Symbol
- -
- Assembly
- GCA_949820665.1
- Location
- OX463324.1:1711192-1711623[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.28 6.1e+03 -1.3 0.1 27 38 8 20 5 32 0.66 2 4 0.0007 15 7.0 0.0 21 43 58 80 49 85 0.87 3 4 0.00025 5.6 8.4 0.0 22 44 87 109 78 112 0.88 4 4 5.1e-05 1.1 10.7 0.0 26 48 117 139 110 141 0.90
Sequence Information
- Coding Sequence
- ATGCGACCGAACCGCTATAGATGCCGGCTCTGCTCCGCGATGGTGACTAACACATCCAGAACTTCACACATGGAGAAATACCACGACATACCGGCGCCGAAATGCAATATTTGCGATAAGAAATTCCTCTACCCGCATCTGCTCATCAACCATCAGCGCATAGAACATTTAGGCGAGAAGAACTTTACGTGTGAAATTTGCGCAGCCGCGTTCGCGACGTCCAGTTCTCTGACCAAACATAAATTCTCGCATGTAGACCAGAGGCCTTGGGACTGTAAACTGTGCGGGAAGTCTTttaagcagaagaagaatttgaagAAACATATGGCTGGCCACCCGAAGAATGTTATTTGTCCGATCTGCGATGCGGCGTTTTGCGTCGCGAGCGATCTCAAGGAACATTTAGAAGAAGCGCATCctgaattattttaa
- Protein Sequence
- MRPNRYRCRLCSAMVTNTSRTSHMEKYHDIPAPKCNICDKKFLYPHLLINHQRIEHLGEKNFTCEICAAAFATSSSLTKHKFSHVDQRPWDCKLCGKSFKQKKNLKKHMAGHPKNVICPICDAAFCVASDLKEHLEEAHPELF
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01337254; iTF_01337079;
- 90% Identity
- iTF_01337254; iTF_01337079;
- 80% Identity
- iTF_01337254; iTF_01337079;