Basic Information

Insect: Scaptomyza hsui
Gene Symbol: TFAM
Assembly: GCA_018152825.1
Location: JAECXO010000003.1:101152-102077[+]

Transcription Factor Domain

TF Family: HMG
Domain: HMG_box domain
PFAM: PF00505
TF Group: Other Alpha-Helix Group
Description: High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 9.7e-17 9.6e-14 51.7 1.0 1 68 81 148 81 149 0.98

2 2 9.4e-10 9.3e-07 29.3 2.5 1 67 186 251 186 253 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	9.7e-17	9.6e-14	51.7	1.0	1	68	81	148	81	149	0.98
2	2	9.4e-10	9.3e-07	29.3	2.5	1	67	186	251	186	253	0.94

Sequence Information

Coding Sequence: ATGATCTACGCAACGACGCTGCTCTCGCGGAGCTCTATCATCGGCTCGCTAATAAGCAAAGTCAGGCAAGTTGTAGCCAAAAACCAAGACACTGCACATACAAATGAAATCAACAACAATTTAACACCTACGTCCATATCCATGTCAAACGCAAACAGACCCTTGGCCGCTGCTAGCATTAGCCACAGTTCGGTGCATCAGTCAAAGACGCTAGAGGAGCAGATTGGACTGCCGCCAAGACCTAAGAAACCGCTGACGCCATACTTTCGCTTTATGCGCGAAATGCGACCTACGCTGATTGCAAAGAACCCAAAGATAACTACAATTGAGGTTGTGCAACAACTGTCAAAGAACTGGGTGGATGTCGATCCTAAGCTAAAGGAGCGCCTTCAGTCAGAGTACAAAAAGGATCAGGAGATTTACCTGGAGCAGCGCACCAAGTACGATGCAAAACTGACTGACGAGCAACGCGCCGAAATAAAGCAGATTAAACAGGACATAAGCGATGCCAAAGAGCGAAAGCAGCTACGAAAACGCGTCAAGGAGCTCGGACGCCCCAAGAAGCCGGCCTCCGCTTTTCTGCGCTTTGTAGCCATTGAGCGCACAAACACGCCGCAAACACCACAACAAACATACCGTGAATGGCATCAAAAGGCAACTGCCAAATGGACACGCCTTTCCGATGAAGAGAAGGCCGTCTATCTGCGGGAGTCCCGCAAAGAGCTCGATCAGTACAAAACAGCAATTTCGATTTGGGAGGAAAAAATGATACGTCTGGGCCATATCGATGTTGTACGTCATGGCAATCTTATCGATCCGCCAGAGCCCAAAGCACGCAAGTCTCAAGCTCTTAAAGAGAAGTAG
Protein Sequence: MIYATTLLSRSSIIGSLISKVRQVVAKNQDTAHTNEINNNLTPTSISMSNANRPLAAASISHSSVHQSKTLEEQIGLPPRPKKPLTPYFRFMREMRPTLIAKNPKITTIEVVQQLSKNWVDVDPKLKERLQSEYKKDQEIYLEQRTKYDAKLTDEQRAEIKQIKQDISDAKERKQLRKRVKELGRPKKPASAFLRFVAIERTNTPQTPQQTYREWHQKATAKWTRLSDEEKAVYLRESRKELDQYKTAISIWEEKMIRLGHIDVVRHGNLIDPPEPKARKSQALKEK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00537485;
90% Identity: iTF_01320438;
80% Identity: -