Basic Information

Transcription Factor Domain

TF Family: PC4
Domain: PC4 domain
PFAM: PF02229
TF Group: Unclassified Structure
Description: This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 0.093 1.2e+03 -1.4 0.3 31 38 25 32 20 32 0.72

2 2 5.4e-28 7.2e-24 82.6 0.9 1 51 54 104 54 105 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	0.093	1.2e+03	-1.4	0.3	31	38	25	32	20	32	0.72
2	2	5.4e-28	7.2e-24	82.6	0.9	1	51	54	104	54	105	0.97

Coding Sequence: atgccaaaaattagCAAGAAAAAACCGGCGCCCTCTTCATCGGACAGCGACAGTGGTCCAGATGATCGCAATCAGCCACCGCCAAGCAAGAAAGGCAAAGAAGCCGGTAAGCCCGCTTCTGCTCCCGCCAAAGACAGTGGCGGTGATGGCGCGACATCCTGGACTTTGGAGAAACTGCGTCAAGTGCGCATTAACGAGTTCCGTGGACGTAAGATGGTGGACATACGCGAATTCTACGAAAAAGACGGAGAAATATTGCCCGGCAAAAAGGGTATCTCCTTGTCCATTACACAGTGGAAGAAGCTGCTGGAAGTGGCCGATGAAGTCAATCGGGCTGTAGATGATTAG
Protein Sequence: MPKISKKKPAPSSSDSDSGPDDRNQPPPSKKGKEAGKPASAPAKDSGGDGATSWTLEKLRQVRINEFRGRKMVDIREFYEKDGEILPGKKGISLSITQWKKLLEVADEVNRAVDD

Sequence clustering based on sequence similarity using MMseqs2