Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 0.46 8.7e+02 0.4 0.1 3 16 9 22 7 35 0.72

2 2 2.2e-13 4.1e-10 39.9 11.2 5 69 132 196 128 197 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	0.46	8.7e+02	0.4	0.1	3	16	9	22	7	35	0.72
2	2	2.2e-13	4.1e-10	39.9	11.2	5	69	132	196	128	197	0.96

Coding Sequence: atgactTGCCAGGGACGAGATGATTCTCAATATGTGCGCTGTCTGAAGTGCCTGAAGGTGGTGCAATGCTCCAGATATGACACCGGTGGACTGGTCAGCCACATACAAAACGATCATCCGGAAATTATTGAGAGTGCCAATGAGAAGGTGAAGAACCTACATAAACTGGCCGCTCAGCATGGCATAAGCGAGGAGCGTTTATCCGAAATAAGCCATTTGACCGGCATGTCCGAGTGCCAAATGGCCGATGAAGCCGAGCGTTATATGGCTAAGCATAAGACAGCTAACCTGGGGTATATCGGTGATAAAAGCAATCCCAAAAGCACTTGTAATAATCATGTTAAACGTAAACATTATCGCTCTACAATAGAGAAATGGACTCCTAGCGATGGCTGCATCTACTGTCCCAATTGTAGCTCCAATCGTCGACCGCTTATCAGGACCAGCGCCGAGCTGCATAACAACAAAGGCTGCTGCGCCAACTGTGTGGCCAGTTGTTGgccattttgctttttgccctGTCTCATTTCGCCTGAGAATAAAGAGTACTTGCACTGTTCCAATTGCCGCACCTTTTTGGGACTTTACGATCGTGAGAAGAACTGCATCAAGCCCAATCGTGAGTTCGTGGCCTGTGAAGTAACttgtcaaaattaa
Protein Sequence: MTCQGRDDSQYVRCLKCLKVVQCSRYDTGGLVSHIQNDHPEIIESANEKVKNLHKLAAQHGISEERLSEISHLTGMSECQMADEAERYMAKHKTANLGYIGDKSNPKSTCNNHVKRKHYRSTIEKWTPSDGCIYCPNCSSNRRPLIRTSAELHNNKGCCANCVASCWPFCFLPCLISPENKEYLHCSNCRTFLGLYDREKNCIKPNREFVACEVTCQN

Sequence clustering based on sequence similarity using MMseqs2