Basic Information

Transcription Factor Domain

TF Family: Runt
Domain: Runt domain
PFAM: PF00853
TF Group: Beta-Scaffold Factors
Description: The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 1.1e-53 1.1e-49 169.0 0.0 2 95 51 144 50 145 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	1.1e-53	1.1e-49	169.0	0.0	2	95	51	144	50	145	0.97

Coding Sequence: ATGTTTGGTGACTGGGCGTCTACTACCATGCACCTAACCAACACACCCACGGGTGCCACGGGTACCGCCTCTTCGCCGGAGGGTACCACGAGCCTGATCCAGGACACCTACACCAAGATGACCTCCGACATTCTCGCGGAAAGGACACTGAATGACTTTTTGAGTGAACATCCGGGGGAACTGATCAGGACCGGTAGTCCTCTGTTCGTCTGTACGGTACTGCCTCCACATTGGAGGTCAAATAAGACCCTTCCGGTGGCATTTAAGGTGGTGGCCCTCGGAGACATCGGTGACGGGACCGTAGTGACCGTGAAGGCGGGAAACGATGAGAATTATTGTGCGGAGTTAAGGAACTGTACTGCTgttatgaaaaatcaagtagctAAATTTAATGACCTTAGGTTTGTTGGACGAAGTGGAAGAGGTAAGAGATGGTAA
Protein Sequence: MFGDWASTTMHLTNTPTGATGTASSPEGTTSLIQDTYTKMTSDILAERTLNDFLSEHPGELIRTGSPLFVCTVLPPHWRSNKTLPVAFKVVALGDIGDGTVVTVKAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKRW

Sequence clustering based on sequence similarity using MMseqs2