Rped013791.1
Basic Information
- Insect
- Riptortus pedestris
- Gene Symbol
- -
- Assembly
- GCA_019009955.1
- Location
- GWHBAZH00000005:146843520-146848285[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.00098 0.78 10.0 0.2 17 48 65 96 59 102 0.87 2 6 0.32 2.5e+02 2.0 0.1 26 48 103 125 100 127 0.84 3 6 0.00081 0.64 10.3 0.5 21 48 127 154 122 158 0.85 4 6 0.07 55 4.1 0.2 22 48 157 183 153 188 0.84 5 6 0.0053 4.2 7.6 0.3 16 48 180 212 176 215 0.88 6 6 0.00039 0.31 11.3 1.0 21 48 214 241 210 243 0.90
Sequence Information
- Coding Sequence
- ATGAGCTGCAATAAGGATTTCGAATGTGGTGAAGAAGCCATTATGGAGTGTGTTTTCATTAAAGAAGAAAATGTTTCTGACGTGGATTTGGAAACAACTCCTGATCAACAGGTGGGTGATGCTGATTCAGAATGTAGTGTTGAAACGCCAGAGATTGCAGCCAGCTGCTCGAGCCACGAACAAGACTTCACATCGTCAAGTATCAGCACAACAAGCAATGATTGCCCCCATTGTGAATTCAGCACTGCTCAACGGGGCAATTTGAAGAGGCACATTATGGCCAAGCATACTTTCATCAAGCGTTATGCTTGTCCTCTTTGTGATTATAGCGCTGTTCATTCGACGCCATTAAAATACCACATTAAAGCCAAGCATAGCAACGACAGGCCTTACACTTGCCCACATTGTAAGTATAGTGCTGTCCAAAAAGCTCACCTCAAGATTCATATAGAGGCTAAGCACACAAATGAAAAAAATCGTCTTTGCCCATATTGTGATTACAGTGCCGTTCAATCGTACGCGTTGAATTATCACATCAAGTCGAAGCACAGCAACGACAAACCTAATCGTTGCCCTCATTGTGATTATCGTGCTGTTCAGGCTGTTGATTTAAAGAAGCACATCATGACTAAGCACAGTAATGATAAACCATATGCTTGCCCCCATTGTAATCACAGCTGTTCTCGCTCTTCCAATTTAAAGAAACATATTAAGGCTAAACACTCGAATGATTAA
- Protein Sequence
- MSCNKDFECGEEAIMECVFIKEENVSDVDLETTPDQQVGDADSECSVETPEIAASCSSHEQDFTSSSISTTSNDCPHCEFSTAQRGNLKRHIMAKHTFIKRYACPLCDYSAVHSTPLKYHIKAKHSNDRPYTCPHCKYSAVQKAHLKIHIEAKHTNEKNRLCPYCDYSAVQSYALNYHIKSKHSNDKPNRCPHCDYRAVQAVDLKKHIMTKHSNDKPYACPHCNHSCSRSSNLKKHIKAKHSND
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01309773;
- 90% Identity
- iTF_01309773;
- 80% Identity
- iTF_01309773;