Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00098 0.78 10.0 0.2 17 48 65 96 59 102 0.87

2 6 0.32 2.5e+02 2.0 0.1 26 48 103 125 100 127 0.84

3 6 0.00081 0.64 10.3 0.5 21 48 127 154 122 158 0.85

4 6 0.07 55 4.1 0.2 22 48 157 183 153 188 0.84

5 6 0.0053 4.2 7.6 0.3 16 48 180 212 176 215 0.88

6 6 0.00039 0.31 11.3 1.0 21 48 214 241 210 243 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00098	0.78	10.0	0.2	17	48	65	96	59	102	0.87
2	6	0.32	2.5e+02	2.0	0.1	26	48	103	125	100	127	0.84
3	6	0.00081	0.64	10.3	0.5	21	48	127	154	122	158	0.85
4	6	0.07	55	4.1	0.2	22	48	157	183	153	188	0.84
5	6	0.0053	4.2	7.6	0.3	16	48	180	212	176	215	0.88
6	6	0.00039	0.31	11.3	1.0	21	48	214	241	210	243	0.90

Coding Sequence: ATGAGCTGCAATAAGGATTTCGAATGTGGTGAAGAAGCCATTATGGAGTGTGTTTTCATTAAAGAAGAAAATGTTTCTGACGTGGATTTGGAAACAACTCCTGATCAACAGGTGGGTGATGCTGATTCAGAATGTAGTGTTGAAACGCCAGAGATTGCAGCCAGCTGCTCGAGCCACGAACAAGACTTCACATCGTCAAGTATCAGCACAACAAGCAATGATTGCCCCCATTGTGAATTCAGCACTGCTCAACGGGGCAATTTGAAGAGGCACATTATGGCCAAGCATACTTTCATCAAGCGTTATGCTTGTCCTCTTTGTGATTATAGCGCTGTTCATTCGACGCCATTAAAATACCACATTAAAGCCAAGCATAGCAACGACAGGCCTTACACTTGCCCACATTGTAAGTATAGTGCTGTCCAAAAAGCTCACCTCAAGATTCATATAGAGGCTAAGCACACAAATGAAAAAAATCGTCTTTGCCCATATTGTGATTACAGTGCCGTTCAATCGTACGCGTTGAATTATCACATCAAGTCGAAGCACAGCAACGACAAACCTAATCGTTGCCCTCATTGTGATTATCGTGCTGTTCAGGCTGTTGATTTAAAGAAGCACATCATGACTAAGCACAGTAATGATAAACCATATGCTTGCCCCCATTGTAATCACAGCTGTTCTCGCTCTTCCAATTTAAAGAAACATATTAAGGCTAAACACTCGAATGATTAA
Protein Sequence: MSCNKDFECGEEAIMECVFIKEENVSDVDLETTPDQQVGDADSECSVETPEIAASCSSHEQDFTSSSISTTSNDCPHCEFSTAQRGNLKRHIMAKHTFIKRYACPLCDYSAVHSTPLKYHIKAKHSNDRPYTCPHCKYSAVQKAHLKIHIEAKHTNEKNRLCPYCDYSAVQSYALNYHIKSKHSNDKPNRCPHCDYRAVQAVDLKKHIMTKHSNDKPYACPHCNHSCSRSSNLKKHIKAKHSND

Sequence clustering based on sequence similarity using MMseqs2