Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 2.2 1.8e+03 -0.7 0.4 37 48 73 83 64 88 0.69

2 6 9.3e-05 0.074 13.3 0.9 17 49 86 118 82 122 0.83

3 6 0.017 14 6.0 0.9 20 48 118 146 114 147 0.77

4 6 7.9e-05 0.062 13.5 1.2 16 48 143 175 138 178 0.90

5 6 1.2e-05 0.0094 16.1 1.0 19 48 175 204 172 207 0.89

6 6 0.013 10 6.4 0.7 19 48 204 233 201 236 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	2.2	1.8e+03	-0.7	0.4	37	48	73	83	64	88	0.69
2	6	9.3e-05	0.074	13.3	0.9	17	49	86	118	82	122	0.83
3	6	0.017	14	6.0	0.9	20	48	118	146	114	147	0.77
4	6	7.9e-05	0.062	13.5	1.2	16	48	143	175	138	178	0.90
5	6	1.2e-05	0.0094	16.1	1.0	19	48	175	204	172	207	0.89
6	6	0.013	10	6.4	0.7	19	48	204	233	201	236	0.79

Coding Sequence: ATGAGGCCGAACTGCACAACATATAGCGACTCACTTCAACATACTGCAACCTGTCGACAAGGAGAGTTCCGTATCAAAAAACTGAAGTCACCATCCACTGGAATAAAACCATCAAGGAGCTATATAAGTTCAAGGCGAGAAATGAATCTATCTAAGGAATGCTCAACTGTAACTGCTGGCGCTGAGAAAAATTTTCCGTGTTGTGAATGCAGTTTCAGCACCAATTATAGACACCACCTAAACCGTCACTTATTGTCTAAACATTCAAGTGACAAACCTCACTCCTGCCCCTACTGTGAATACAGTACTGTTGGCAGGAGCAATCTAAAGCGTCACATACAGGGAAAACATTCAAGCAATAAACCTCACTCATGCCCTTACTGTGAATACAGTACTGTTCACAGGGGCAATCTAAATCACCACATACGGAGTAAACATTCAAGCAACAAACCTCACTCATGCCCCCACTGTGAATACAGTGCTGTTCATAGTGTCAATCTAAAGTATCACATACAGGCTAAACATTCAAGTGACAAACCTCACTCCTGCCCCTACTGTGAATACAGTACTGTTCAGGCTTGCAATCTAAAGCGTCACATACAGGCTAAACATACAAGTGACAAACCTCATTCTTGCCCCTACTGTGAATACAGTGCTGTTCGTGGAGACTCTTTAAAGTGTCACATACAGGCTAAACACGGTAGAGAAAAATCTCCCTTATAG
Protein Sequence: MRPNCTTYSDSLQHTATCRQGEFRIKKLKSPSTGIKPSRSYISSRREMNLSKECSTVTAGAEKNFPCCECSFSTNYRHHLNRHLLSKHSSDKPHSCPYCEYSTVGRSNLKRHIQGKHSSNKPHSCPYCEYSTVHRGNLNHHIRSKHSSNKPHSCPHCEYSAVHSVNLKYHIQAKHSSDKPHSCPYCEYSTVQACNLKRHIQAKHTSDKPHSCPYCEYSAVRGDSLKCHIQAKHGREKSPL

Sequence clustering based on sequence similarity using MMseqs2