Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0028 2.3 8.5 0.3 22 48 7 33 2 36 0.86

2 6 0.0077 6.1 7.1 0.5 19 48 33 62 26 64 0.84

3 6 0.0037 2.9 8.2 0.1 18 48 61 91 59 92 0.81

4 6 0.025 20 5.5 0.4 19 48 91 120 88 122 0.82

5 6 0.0012 0.97 9.7 0.7 19 49 120 150 113 153 0.85

6 6 0.00044 0.35 11.1 0.4 21 49 151 179 149 183 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0028	2.3	8.5	0.3	22	48	7	33	2	36	0.86
2	6	0.0077	6.1	7.1	0.5	19	48	33	62	26	64	0.84
3	6	0.0037	2.9	8.2	0.1	18	48	61	91	59	92	0.81
4	6	0.025	20	5.5	0.4	19	48	91	120	88	122	0.82
5	6	0.0012	0.97	9.7	0.7	19	49	120	150	113	153	0.85
6	6	0.00044	0.35	11.1	0.4	21	49	151	179	149	183	0.87

Coding Sequence: ATGGCTAAACATTCAATGGACAACCCTCACACCTGCCCTTACTGTGAATACAGTGCTGTCCAAGCTGGCCATCTAAAGCCACACATACAGGCTAAACATTCAAAGGAGAAACCACACTTATGCCCTTACTGTGAATACTGTGCTACTTGGGCTGGCAATCTAAAGCAACACATACTGTCTAAACATTCTGAGGAAAGACCCCATTCATGCCCCTACTGTGAATACAGTGGTGTTCATGCAGGAAATCTTAAGAAGCACATTCTGGCTAAACATTCCAGTGAAAAACCTTACTCCTGCCTCTACTGTGATTACTCTACTGTTCGGGCTAGCCATCTGAAGCATCACATACTGGCTAAACATTCAAGTGACAAACCTCACTCCTGCCCCTACTGTGAATACAGTACTGTTCATAAGAGTTATCTAAACCGTCATATACAGGCTAATCATTTAAGTGGCAAACCTCACTCCTGCCCATACTGTGAATATAGTACTGTTCAAGCTGGCAGGCTAAAACGCCACATACAGGCTAAGCATACAAGTGACAAATCTCCCTTATAG
Protein Sequence: MAKHSMDNPHTCPYCEYSAVQAGHLKPHIQAKHSKEKPHLCPYCEYCATWAGNLKQHILSKHSEERPHSCPYCEYSGVHAGNLKKHILAKHSSEKPYSCLYCDYSTVRASHLKHHILAKHSSDKPHSCPYCEYSTVHKSYLNRHIQANHLSGKPHSCPYCEYSTVQAGRLKRHIQAKHTSDKSPL

Sequence clustering based on sequence similarity using MMseqs2