Rped013811.1
Basic Information
- Insect
- Riptortus pedestris
- Gene Symbol
- -
- Assembly
- GCA_019009955.1
- Location
- GWHBAZH00000005:147221894-147222451[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.0028 2.3 8.5 0.3 22 48 7 33 2 36 0.86 2 6 0.0077 6.1 7.1 0.5 19 48 33 62 26 64 0.84 3 6 0.0037 2.9 8.2 0.1 18 48 61 91 59 92 0.81 4 6 0.025 20 5.5 0.4 19 48 91 120 88 122 0.82 5 6 0.0012 0.97 9.7 0.7 19 49 120 150 113 153 0.85 6 6 0.00044 0.35 11.1 0.4 21 49 151 179 149 183 0.87
Sequence Information
- Coding Sequence
- ATGGCTAAACATTCAATGGACAACCCTCACACCTGCCCTTACTGTGAATACAGTGCTGTCCAAGCTGGCCATCTAAAGCCACACATACAGGCTAAACATTCAAAGGAGAAACCACACTTATGCCCTTACTGTGAATACTGTGCTACTTGGGCTGGCAATCTAAAGCAACACATACTGTCTAAACATTCTGAGGAAAGACCCCATTCATGCCCCTACTGTGAATACAGTGGTGTTCATGCAGGAAATCTTAAGAAGCACATTCTGGCTAAACATTCCAGTGAAAAACCTTACTCCTGCCTCTACTGTGATTACTCTACTGTTCGGGCTAGCCATCTGAAGCATCACATACTGGCTAAACATTCAAGTGACAAACCTCACTCCTGCCCCTACTGTGAATACAGTACTGTTCATAAGAGTTATCTAAACCGTCATATACAGGCTAATCATTTAAGTGGCAAACCTCACTCCTGCCCATACTGTGAATATAGTACTGTTCAAGCTGGCAGGCTAAAACGCCACATACAGGCTAAGCATACAAGTGACAAATCTCCCTTATAG
- Protein Sequence
- MAKHSMDNPHTCPYCEYSAVQAGHLKPHIQAKHSKEKPHLCPYCEYCATWAGNLKQHILSKHSEERPHSCPYCEYSGVHAGNLKKHILAKHSSEKPYSCLYCDYSTVRASHLKHHILAKHSSDKPHSCPYCEYSTVHKSYLNRHIQANHLSGKPHSCPYCEYSTVQAGRLKRHIQAKHTSDKSPL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01309799;
- 90% Identity
- iTF_01309799;
- 80% Identity
- iTF_01309799;