Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00016 0.12 12.5 0.6 23 48 45 70 34 71 0.85

2 9 0.0048 3.8 7.8 0.3 19 48 70 99 67 104 0.85

3 9 0.064 51 4.2 0.5 21 48 101 128 97 129 0.82

4 9 0.032 25 5.1 0.3 17 44 126 153 124 158 0.75

5 9 0.0047 3.7 7.8 0.2 18 48 156 186 146 187 0.85

6 9 0.00043 0.34 11.1 0.1 17 49 184 216 176 220 0.82

7 9 0.0015 1.2 9.4 2.3 21 50 217 246 212 251 0.79

8 9 0.031 24 5.2 0.9 22 48 247 273 245 276 0.81

9 9 0.066 53 4.1 0.3 21 48 275 302 271 304 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00016	0.12	12.5	0.6	23	48	45	70	34	71	0.85
2	9	0.0048	3.8	7.8	0.3	19	48	70	99	67	104	0.85
3	9	0.064	51	4.2	0.5	21	48	101	128	97	129	0.82
4	9	0.032	25	5.1	0.3	17	44	126	153	124	158	0.75
5	9	0.0047	3.7	7.8	0.2	18	48	156	186	146	187	0.85
6	9	0.00043	0.34	11.1	0.1	17	49	184	216	176	220	0.82
7	9	0.0015	1.2	9.4	2.3	21	50	217	246	212	251	0.79
8	9	0.031	24	5.2	0.9	22	48	247	273	245	276	0.81
9	9	0.066	53	4.1	0.3	21	48	275	302	271	304	0.83

Coding Sequence: ATGGGCAACACAAATTCAAGGCGGGAAGTGGATCTATCGATGCATTGCTCACCTTCTACTACTGAAGATTGCTTTGAATATAGTGCAGTTCAGGTTGACACCCTAAAGCAGGACATACAGGCTAAATGTTCAAATCATAAAACCTGCCCCTACTGTGAGTACAGTACGGTTCAGACCAACAATCTAAAGCGTCACATTCAGGCTAAACATTCAAGCGAGAAACCTCACCCCTGCCCCTACTGTGAATACAGTGCTGCCTTGGCTGACACTCTAAAGCGGCATATACTGGCTAAACATTCAGGTGACAAACCTCACTCCTGCCCATACTGTGAATACACTGCTGTTCAGGCTGCCCATCTAAAGTACCACATACTGTCTAAACATTCAAGTGACAAACCCCACTATTGCCCCTACTGTGAATACAGTACTGTTCGGGCTGGTGATCTTAAGCCCCACATATTGGCCAAACATTCAAGCAATAAACCTCACCCCTGCCCCTACTGCGAATACAGTGCAGTCCAGACTGGTACCCTAAAACAGCACATTCAGGCTAAACACACAAGTGAAAAACCTCACTTCTGCCCACACTGTGATTACAGTGCTGTTCACGGAGGGAATCTAAAGAAGCACATTCAGGCTAAACATTCTTGTGATAAACCTCACCCTTGCCCCTACTGTGAATACTATGTTGTTCGGGCTGGAGATTTAAAGAGGCACATACAAGCTAAACATTTAATTGACAAACCTCACTGTTGCCCATACTGTGAATACAGTGCTGTTCGTGCTGGCAATCTAAAGCATCACATACTGGCTAAGCATTCAAATGACAAACCTCACTCCTGCCCATATTGTGAATACAGTGCTGCTGTGGGCACCACTCTGAACCGCCACATACGGGCGAAGCACACAGGACTCCTATCTCCCTCATAA
Protein Sequence: MGNTNSRREVDLSMHCSPSTTEDCFEYSAVQVDTLKQDIQAKCSNHKTCPYCEYSTVQTNNLKRHIQAKHSSEKPHPCPYCEYSAALADTLKRHILAKHSGDKPHSCPYCEYTAVQAAHLKYHILSKHSSDKPHYCPYCEYSTVRAGDLKPHILAKHSSNKPHPCPYCEYSAVQTGTLKQHIQAKHTSEKPHFCPHCDYSAVHGGNLKKHIQAKHSCDKPHPCPYCEYYVVRAGDLKRHIQAKHLIDKPHCCPYCEYSAVRAGNLKHHILAKHSNDKPHSCPYCEYSAAVGTTLNRHIRAKHTGLLSPS

Sequence clustering based on sequence similarity using MMseqs2