Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00027 0.22 11.8 0.3 20 48 5 33 2 35 0.89

2 5 0.00063 0.5 10.6 0.5 18 48 32 62 30 65 0.84

3 5 0.00035 0.28 11.4 0.5 21 49 64 92 59 94 0.80

4 5 0.00058 0.46 10.7 0.3 19 48 91 120 90 125 0.85

5 5 0.059 47 4.3 0.1 22 48 123 149 119 152 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00027	0.22	11.8	0.3	20	48	5	33	2	35	0.89
2	5	0.00063	0.5	10.6	0.5	18	48	32	62	30	65	0.84
3	5	0.00035	0.28	11.4	0.5	21	49	64	92	59	94	0.80
4	5	0.00058	0.46	10.7	0.3	19	48	91	120	90	125	0.85
5	5	0.059	47	4.3	0.1	22	48	123	149	119	152	0.84

Coding Sequence: ATGACGAAGCATACTGCTGAAAAACCTCTCTCTTGCCCCCATTGTGATTACAGTGCAGTCCAATCTAGCACCTTAAAGTATCACATAATGGCTAGACATACTCATGACAAGCCTTTCACTTGTCCACATTGTGTATATAGTACTGTTAAAAAGAGATCCTTGAAACATCATATAATTGCTAAACATACAAATGACAAACCTCTTACTTGCCCTCACTGTGAATTCAGTACAGTGCGCAATGGTTCATTAAAACGCCATATAATGGCCAGGCACACATGTGAAAAACCTCTCAACTGCCCACACTGCGATTATAGTACCGTTGAGTCTGGTTCATTGAAGAGGCATATAATGGCTAAACATACACATGATAAGCCCCTCAAGTGTACCTATTGTGATTTAAGCACTGTTAATTTTAGTGATTTAAAGCGCCACTTGATGGTTAAGCACTCCAATGCTTCTTAA
Protein Sequence: MTKHTAEKPLSCPHCDYSAVQSSTLKYHIMARHTHDKPFTCPHCVYSTVKKRSLKHHIIAKHTNDKPLTCPHCEFSTVRNGSLKRHIMARHTCEKPLNCPHCDYSTVESGSLKRHIMAKHTHDKPLKCTYCDLSTVNFSDLKRHLMVKHSNAS

Sequence clustering based on sequence similarity using MMseqs2