Basic Information

Gene Symbol
-
Assembly
GCA_019009955.1
Location
GWHBAZH00000001:139596314-139603351[-]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 10 0.0014 1.1 9.5 0.4 20 49 21 50 11 52 0.83
2 10 0.0025 2 8.7 0.3 22 49 52 79 50 81 0.84
3 10 0.0026 2.1 8.7 0.3 22 49 81 108 79 110 0.84
4 10 0.0026 2.1 8.6 0.3 22 49 110 137 108 139 0.84
5 10 0.0045 3.6 7.9 0.5 21 49 138 166 135 168 0.84
6 10 0.0072 5.7 7.2 0.8 21 49 167 195 163 196 0.83
7 10 0.0003 0.24 11.6 1.1 21 49 196 224 191 228 0.85
8 10 0.099 78 3.6 0.4 22 48 226 252 224 254 0.76
9 10 0.00023 0.18 12.0 0.4 21 49 254 282 249 286 0.86
10 10 0.22 1.7e+02 2.5 0.2 25 48 287 310 283 314 0.82

Sequence Information

Coding Sequence
ATGGCCTATCAAAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATACAGGCTAAACATTTAAATGAAAGACCTCATTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACCTACAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACCTACATGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGTTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGATGTTCGGGCTGATACCATAAAGAAGCACATACAGGCTAACCATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGTTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGATAAATCTCACTCCTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGGCCGGCTAAAGAGCCACATATCGGCTAAGCACACAGGACACCAATCTCCCTTATAG
Protein Sequence
MAYQSAVRADTIKKHIQAKHLNERPHSCPYCEYSAVRADTIKKHIEAKHLNERPHSCPYCEYSAVRADTIKKHIEAKHLNERPHSCPYCEYSAVRADTIKKHIEAKHLNERPHSCPYCEYSAVRADTIKKHIEAKHLNERPHSCPYCEYSAVRADTIKKHLQAKHLNERPHSCPYCEYSAVRADTIKKHLHAKHLNERPHSCPYCEYSVVRADTIKKHIEAKHLNERPHSCPYCEYSDVRADTIKKHIQANHLNERPHSCPYCEYSVVRADTIKKHIEAKHLNDKSHSCPYCEYSAVRAGRLKSHISAKHTGHQSPL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01309757;
90% Identity
iTF_01309757;
80% Identity
iTF_01309757;