Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0014 1.1 9.5 0.4 20 49 21 50 11 52 0.83

2 10 0.0025 2 8.7 0.3 22 49 52 79 50 81 0.84

3 10 0.0026 2.1 8.7 0.3 22 49 81 108 79 110 0.84

4 10 0.0026 2.1 8.6 0.3 22 49 110 137 108 139 0.84

5 10 0.0045 3.6 7.9 0.5 21 49 138 166 135 168 0.84

6 10 0.0072 5.7 7.2 0.8 21 49 167 195 163 196 0.83

7 10 0.0003 0.24 11.6 1.1 21 49 196 224 191 228 0.85

8 10 0.099 78 3.6 0.4 22 48 226 252 224 254 0.76

9 10 0.00023 0.18 12.0 0.4 21 49 254 282 249 286 0.86

10 10 0.22 1.7e+02 2.5 0.2 25 48 287 310 283 314 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0014	1.1	9.5	0.4	20	49	21	50	11	52	0.83
2	10	0.0025	2	8.7	0.3	22	49	52	79	50	81	0.84
3	10	0.0026	2.1	8.7	0.3	22	49	81	108	79	110	0.84
4	10	0.0026	2.1	8.6	0.3	22	49	110	137	108	139	0.84
5	10	0.0045	3.6	7.9	0.5	21	49	138	166	135	168	0.84
6	10	0.0072	5.7	7.2	0.8	21	49	167	195	163	196	0.83
7	10	0.0003	0.24	11.6	1.1	21	49	196	224	191	228	0.85
8	10	0.099	78	3.6	0.4	22	48	226	252	224	254	0.76
9	10	0.00023	0.18	12.0	0.4	21	49	254	282	249	286	0.86
10	10	0.22	1.7e+02	2.5	0.2	25	48	287	310	283	314	0.82

Coding Sequence: ATGGCCTATCAAAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATACAGGCTAAACATTTAAATGAAAGACCTCATTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACCTACAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGATACCATAAAGAAGCACCTACATGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGTTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGATGTTCGGGCTGATACCATAAAGAAGCACATACAGGCTAACCATTTAAATGAAAGACCTCACTCGTGCCCCTACTGTGAATACAGTGTTGTTCGGGCTGATACCATAAAGAAGCACATAGAGGCTAAACATTTAAATGATAAATCTCACTCCTGCCCCTACTGTGAATACAGTGCTGTTCGGGCTGGCCGGCTAAAGAGCCACATATCGGCTAAGCACACAGGACACCAATCTCCCTTATAG
Protein Sequence: MAYQSAVRADTIKKHIQAKHLNERPHSCPYCEYSAVRADTIKKHIEAKHLNERPHSCPYCEYSAVRADTIKKHIEAKHLNERPHSCPYCEYSAVRADTIKKHIEAKHLNERPHSCPYCEYSAVRADTIKKHIEAKHLNERPHSCPYCEYSAVRADTIKKHLQAKHLNERPHSCPYCEYSAVRADTIKKHLHAKHLNERPHSCPYCEYSVVRADTIKKHIEAKHLNERPHSCPYCEYSDVRADTIKKHIQANHLNERPHSCPYCEYSVVRADTIKKHIEAKHLNDKSHSCPYCEYSAVRAGRLKSHISAKHTGHQSPL

Sequence clustering based on sequence similarity using MMseqs2