Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.081 5.4e+02 1.0 0.0 40 50 21 31 17 35 0.88

2 9 0.081 5.4e+02 1.0 0.0 40 50 40 50 36 54 0.88

3 9 0.41 2.8e+03 -1.3 0.0 40 50 59 69 57 73 0.86

4 9 0.081 5.4e+02 1.0 0.0 40 50 78 88 74 92 0.88

5 9 0.078 5.2e+02 1.0 0.0 40 50 97 107 93 112 0.87

6 9 0.014 91 3.5 0.0 38 50 114 126 110 130 0.88

7 9 0.081 5.4e+02 1.0 0.0 40 50 135 145 131 149 0.88

8 9 0.078 5.2e+02 1.0 0.0 40 50 154 164 150 169 0.87

9 9 0.014 91 3.5 0.0 38 50 171 183 167 187 0.88

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.081	5.4e+02	1.0	40	50	21	31	17	35	0.88
2	9	0.081	5.4e+02	1.0	40	50	40	50	36	54	0.88
3	9	0.41	2.8e+03	-1.3	40	50	59	69	57	73	0.86
4	9	0.081	5.4e+02	1.0	40	50	78	88	74	92	0.88
5	9	0.078	5.2e+02	1.0	40	50	97	107	93	112	0.87
6	9	0.014	91	3.5	38	50	114	126	110	130	0.88
7	9	0.081	5.4e+02	1.0	40	50	135	145	131	149	0.88
8	9	0.078	5.2e+02	1.0	40	50	154	164	150	169	0.87
9	9	0.014	91	3.5	38	50	171	183	167	187	0.88

Coding Sequence: ATGAACTTTGgggaCTTGGAAATTAAAGTATTTGCTCTAGAATTAGGTTCAGTTTGGAGCATAAGACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTTGGAGCATTAGACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTTGGAGCATTAAACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTTGGAGCATAAGACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTTGGAGCATTAGACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTAGGAGCATTAGACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTTGGAGCATTAGACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTTGGAGCATTAGACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTAGGAGCATTAGACGGGACTTGGAAATTAAAGTATTTGCTCTAAAATTAGGTTCAGTTTGGAGCATTTGA
Protein Sequence: MNFGDLEIKVFALELGSVWSIRRDLEIKVFALKLGSVWSIRRDLEIKVFALKLGSVWSIKRDLEIKVFALKLGSVWSIRRDLEIKVFALKLGSVWSIRRDLEIKVFALKLGSVRSIRRDLEIKVFALKLGSVWSIRRDLEIKVFALKLGSVWSIRRDLEIKVFALKLGSVRSIRRDLEIKVFALKLGSVWSI

Sequence clustering based on sequence similarity using MMseqs2