Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.001 8.1 8.0 0.2 23 48 65 90 50 94 0.85

2 10 0.046 3.7e+02 2.7 0.2 22 45 93 116 91 122 0.75

3 10 0.096 7.6e+02 1.7 0.2 22 48 122 148 117 150 0.78

4 10 0.0002 1.6 10.3 0.5 17 48 146 177 133 181 0.90

5 10 0.0076 60 5.2 0.3 18 49 176 207 174 211 0.87

6 10 0.00016 1.3 10.6 0.3 18 49 205 236 203 240 0.87

7 10 0.00012 0.94 11.0 0.7 18 49 234 265 232 269 0.89

8 10 0.002 16 7.1 0.4 16 48 261 293 260 295 0.90

9 10 0.002 16 7.1 0.5 17 48 291 322 286 324 0.91

10 10 0.00035 2.8 9.5 2.1 18 49 321 352 318 355 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.001	8.1	8.0	0.2	23	48	65	90	50	94	0.85
2	10	0.046	3.7e+02	2.7	0.2	22	45	93	116	91	122	0.75
3	10	0.096	7.6e+02	1.7	0.2	22	48	122	148	117	150	0.78
4	10	0.0002	1.6	10.3	0.5	17	48	146	177	133	181	0.90
5	10	0.0076	60	5.2	0.3	18	49	176	207	174	211	0.87
6	10	0.00016	1.3	10.6	0.3	18	49	205	236	203	240	0.87
7	10	0.00012	0.94	11.0	0.7	18	49	234	265	232	269	0.89
8	10	0.002	16	7.1	0.4	16	48	261	293	260	295	0.90
9	10	0.002	16	7.1	0.5	17	48	291	322	286	324	0.91
10	10	0.00035	2.8	9.5	2.1	18	49	321	352	318	355	0.91

Coding Sequence: ATGGTCTATTATTTTACAGATTCAAGCCCTGCTCCCTCAATTCCGCTGTCAGATGATTCAGCTCAAGATTTGGATTTTTTGGTGGATGAGCAATATTTAGAGTCCATATCTTCAGATGATGTGGTGAGCAAAAGAAATAAAATTGTGAAGAAAAGTAAAGAAGgtgccaaggatagttgcaatagagataagaagtcccatcaatgtccttactgtgattataaatcagtccaatctataaatttgaaaactcatataatggctcgtcatacaggtgagaagtcccatgaatgtcctcactgtgattataaatcagttcgttccgcagatctaaaaagacatataatatcctgtcatacaggtgagaagaaccatcaatgtcctcactgtgattataaatcagtaaaatctagtcaaatgaaaaatcatataatggcccgtcatacaggtgagaagcctcatcaatgtccttactgtgattataaatcagtccaatctatacatttgaaaactcatataatggctcgtcatacaggtgagaagtcccatgaatgtcctcactgtgattacaaatcagtccaatatataaatttgaaaactcatataatggctcgtcatacaggtgagaagtcccatgaatgtcctcactgtgattacaaatcagtccaatctataaatttaaaaaaacatataatggctcgtcatacaggtgagaagccccatgaatgtcctcactgtgattataaatcagttcattccacagatctaaaaagacatataagatcccgtcatacaggtgagaagaaccatcaatgtcctcagtgtgattataaatcagtgctatctggaagtatgaaaagacacataatggcccgtcatacaggtgagaagcctcatcaatgtccccattgtgactttaaatctgttgaatctcaagatttgaaaatccatataatggcccgtcatacaggtgagaagcctcatcaatgtccgcactgtcattataaaactgtaacatctcaatacctgaaaaaacatgtaagggcccgccatacaagtgagaggcttcttaactccccttaa
Protein Sequence: MVYYFTDSSPAPSIPLSDDSAQDLDFLVDEQYLESISSDDVVSKRNKIVKKSKEGAKDSCNRDKKSHQCPYCDYKSVQSINLKTHIMARHTGEKSHECPHCDYKSVRSADLKRHIISCHTGEKNHQCPHCDYKSVKSSQMKNHIMARHTGEKPHQCPYCDYKSVQSIHLKTHIMARHTGEKSHECPHCDYKSVQYINLKTHIMARHTGEKSHECPHCDYKSVQSINLKKHIMARHTGEKPHECPHCDYKSVHSTDLKRHIRSRHTGEKNHQCPQCDYKSVLSGSMKRHIMARHTGEKPHQCPHCDFKSVESQDLKIHIMARHTGEKPHQCPHCHYKTVTSQYLKKHVRARHTSERLLNSP

Sequence clustering based on sequence similarity using MMseqs2