Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00041 3.3 9.3 0.2 18 49 8 39 4 43 0.88

2 8 2.7e-06 0.021 16.3 0.8 18 49 37 68 36 70 0.91

3 8 3.6e-05 0.29 12.7 0.4 18 49 66 97 64 101 0.91

4 8 0.00037 3 9.4 0.0 21 48 127 154 123 158 0.90

5 8 0.026 2.1e+02 3.5 0.1 22 49 157 184 154 188 0.86

6 8 0.0037 30 6.2 0.4 16 48 180 212 172 215 0.82

7 8 0.002 16 7.1 0.0 18 48 211 241 209 245 0.81

8 8 0.019 1.5e+02 3.9 0.5 20 49 242 271 240 276 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00041	3.3	9.3	0.2	18	49	8	39	4	43	0.88
2	8	2.7e-06	0.021	16.3	0.8	18	49	37	68	36	70	0.91
3	8	3.6e-05	0.29	12.7	0.4	18	49	66	97	64	101	0.91
4	8	0.00037	3	9.4	0.0	21	48	127	154	123	158	0.90
5	8	0.026	2.1e+02	3.5	0.1	22	49	157	184	154	188	0.86
6	8	0.0037	30	6.2	0.4	16	48	180	212	172	215	0.82
7	8	0.002	16	7.1	0.0	18	48	211	241	209	245	0.81
8	8	0.019	1.5e+02	3.9	0.5	20	49	242	271	240	276	0.86

Coding Sequence: atgagaagtcatataattgcccgtcatacatgtgagaagcctcatcaatgtccttattgtgattataaatcagttgaatctggaactatgaaaagacatataatgggccgtcatacaggtgagaagcctcatcaatgtcctaagtgtgtttataaaacattacaatctgcaaatatgaaaagacatataatggcccgacatacatgtgagaagcctcatcaatgtccttattgtgattataaatcattacaatctggaactatgaaaagacatataatggcccgtcatacaggcgagaagtctcatcaatgttcttactgtgattataaatcagttcgatctggatctatgataaatcatataatggtccatcatactggcgaaaaacctcaccaatgtccttactgtgattataaattagtaacatctggaaatattaaaaaacatataatgatccatcatacaggtgagaagtcccatcaatgtcctcactgtgattataaatcagctgaatctggaactatgaaaaaacatatacaggcccgtcatacaggtgagaagcctcatcagtgtcctcactgtgattataaatcggtagaatctggacatatgaaaagtcatatagtggcccgtcacacaggtgagaagtcccatcaatgtcctttctgtggttataaatcggttcgttctggagatctgaaaaaacatataatggcccgtcatacaggtgagatgccgtatcactgtcctcactgtaattataaatcagtacattctggttatatgaaaaaacacataatggcccgtcatacaggtgagaagtctcatcaatgttcttactgtgattataaatcagttcgatctggatctatgaaaaatcatataatggtcgatcatactggcgaaaaacctcactaa
Protein Sequence: MRSHIIARHTCEKPHQCPYCDYKSVESGTMKRHIMGRHTGEKPHQCPKCVYKTLQSANMKRHIMARHTCEKPHQCPYCDYKSLQSGTMKRHIMARHTGEKSHQCSYCDYKSVRSGSMINHIMVHHTGEKPHQCPYCDYKLVTSGNIKKHIMIHHTGEKSHQCPHCDYKSAESGTMKKHIQARHTGEKPHQCPHCDYKSVESGHMKSHIVARHTGEKSHQCPFCGYKSVRSGDLKKHIMARHTGEMPYHCPHCNYKSVHSGYMKKHIMARHTGEKSHQCSYCDYKSVRSGSMKNHIMVDHTGEKPH

Sequence clustering based on sequence similarity using MMseqs2