Rluc011717.1
Basic Information
- Insect
- Reticulitermes lucifugus
- Gene Symbol
- -
- Assembly
- GCA_026260175.1
- Location
- JAKCWW010002164.1:12338-25856[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 3 3e+04 -4.2 0.0 26 30 117 121 111 127 0.72 2 3 1.8e-08 0.00018 22.3 0.3 25 48 142 165 133 167 0.92 3 3 0.00028 2.8 8.8 0.0 26 48 218 240 212 242 0.92
Sequence Information
- Coding Sequence
- ATGACTGGGATAGTTTGCAACTTCTTAAGAGTGCAGTTTGAGGACTACATGACATGTGAGAGTGATATTGTGGTTTATGGATTCCACAGTGTTGGCGAGATGTTGGACCAGCAGTTAGACAGGCCAGAAGAGGAAGTGGCAGAAGACGGAAACATTTTTGGATGCACTGAAAGGGCTAAAAGTGGCCAGAAGTGGCCAATTGGGCAGTGCGAGACATCCATGATTGGTCGAGGCGTTCATCAGTCCTCACTGCCCCAGCTGATGCTCGCAAAGCTGAAATGGGTGGGGGTTCCTGGGTCTTGGCGGGTACAGGGACGCAATTTCCCAGGTGCATCAGGTTCAAGCCATCAGTGCACCATTTGTGGCAAGACATTTCTTGCCCGTGACTCACTTTATAAACATAAGAATATACATAAAGGGACAACAAAGTGTCCCATTTGCCAAGCAGTACTAAGTCGAACTGGCAACATGAGACGGCACATGGTATTAAAACATGAGTGTCTGTGGGTGGGGGATGCTTGGGACTGGCAGGGCATTGCTGGAGTGAACATTGTTCCCCTCATGGATGGGCATCAGTGCAAGATCTGCGGGAAGAAGTTCCTAAACCTGGGTTCTCTGTATAAACACAAGGATGTACACAAGGGGAAGACAAGATGCCCAGTTTGTCAGGTGGTCTTCAGTCGAACTCTGAATATGAAAGCCCATATGAAAACAAAACATGGCTGGTCAGTTTTGTAA
- Protein Sequence
- MTGIVCNFLRVQFEDYMTCESDIVVYGFHSVGEMLDQQLDRPEEEVAEDGNIFGCTERAKSGQKWPIGQCETSMIGRGVHQSSLPQLMLAKLKWVGVPGSWRVQGRNFPGASGSSHQCTICGKTFLARDSLYKHKNIHKGTTKCPICQAVLSRTGNMRRHMVLKHECLWVGDAWDWQGIAGVNIVPLMDGHQCKICGKKFLNLGSLYKHKDVHKGKTRCPVCQVVFSRTLNMKAHMKTKHGWSVL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01289121;
- 90% Identity
- iTF_01289121;
- 80% Identity
- iTF_01289121;