Basic Information

Transcription Factor Domain

TF Family: MBD
Domain: MBD domain
PFAM: PF01429
TF Group: Unclassified Structure
Description: The Methyl-CpG binding domain (MBD) binds to DNA that contains one or more symmetrically methylated CpGs [2]. DNA methylation in animals is associated with alterations in chromatin structure and silencing of gene expression. MBD has negligible non-specific affinity for DNA. In vitro foot-printing with MeCP2 showed the MBD can protect a 12 nucleotide region surrounding a methyl CpG pair [2]. MBDs are found in several Methyl-CpG binding proteins and also DNA demethylase [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 2e-15 3.9e-12 46.2 0.0 2 74 117 189 116 192 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	2e-15	3.9e-12	46.2	0.0	2	74	117	189	116	192	0.89

Coding Sequence: ATGTTATTCGTTAAGGTGGTGAGACCGCATCCAATCCATCGGCTTGATCTTCTACCGGCGAAACGCTTTGATTCGGTTGTTGTGTCCCAGATAGTACATTGGTCAAGAAATTTGGAAAGAGGTGTCTCAAAGCCGAAGAAAAACACAGTAGCCTCTCTGTTAGCTCAAAGTCGAGCTGTTGGTTTGAAACCAATGCTCTCAACACAACAACTGCTTAGTCAAGGAGCTGACTTGGAAAAAATTCGCCAAGCAATAGCTGAAGCTAATTTGACTATGGATGTTTCAACAGACTCTGAAAGTATTGCTGACACAAGTGGCTTATCTGACTCAGATACAGAAGAGCCAATGACAAATCTTAGTGATTTGCGTATTCCATTGGATAAAGGTTGGAAACGTGAAACAATAATTCGTGGTCTCACAAAGAATGGGCAAATTCGGGGTGATGTATTCTATTATGCGCCGGGAAATACTACCAAACTAAAACATATTGGTCAAATTCAAACTATTCTTGATCAAAGCCAATCGAAATTGACACGTGATAACTTCAGTTTTTCGGCTAAAGCAATTATTGGAACATTTCTTCAACCAGCACCAGCTCCTTATGCTACTGATGGTGAATACATTCGCATGACTGACACTGAGGTAGCAAAACGACTTGAAgagttgaaaatgtttacaacGACAAACATTGAATGTTGA
Protein Sequence: MLFVKVVRPHPIHRLDLLPAKRFDSVVVSQIVHWSRNLERGVSKPKKNTVASLLAQSRAVGLKPMLSTQQLLSQGADLEKIRQAIAEANLTMDVSTDSESIADTSGLSDSDTEEPMTNLSDLRIPLDKGWKRETIIRGLTKNGQIRGDVFYYAPGNTTKLKHIGQIQTILDQSQSKLTRDNFSFSAKAIIGTFLQPAPAPYATDGEYIRMTDTEVAKRLEELKMFTTTNIEC

Sequence clustering based on sequence similarity using MMseqs2