Basic Information

Gene Symbol
-
Assembly
GCA_033557875.1
Location
JAWQRP010017617.1:2384-3193[-]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 8 0.017 70 4.5 0.1 21 44 13 36 9 44 0.71
2 8 0.08 3.4e+02 2.3 0.1 21 45 41 65 33 73 0.80
3 8 0.12 5.1e+02 1.8 0.0 20 47 68 95 59 101 0.77
4 8 0.1 4.3e+02 2.0 0.1 21 44 97 120 90 125 0.72
5 8 0.055 2.3e+02 2.9 0.0 21 45 125 149 121 152 0.84
6 8 3.4e-05 0.14 13.2 0.1 18 45 178 205 171 208 0.90
7 8 3.1e-05 0.13 13.3 0.1 21 47 209 235 205 239 0.89
8 8 0.016 69 4.6 0.0 25 48 241 263 235 267 0.84

Sequence Information

Coding Sequence
ATGGAACTATCACAAGAGCAGTTAGGCAATCACTCAACCGAGAAACCGTTTCATTGCCCACTTTGCGATAAGACCTTTTCAAGGAACGCAGGTATGAAGGTGCACTTAAGGTCCCATACCGGGGAGAAGCCGTACCCCTGCAACGTCTGCGAAAAGACATTCGCGTCCACCCACGGCCTCAAATACCACTTAAGCTCCCACTCCGGCGAAAAGCCATATTCTTGTACATTGTGCGACAAGACGTTCGCCAGGGGCGATTATCTGAAGTTGCACATGTCTATTCATACCGGCGAAAAGCCGTTCCCTTGCACGATTTGCGACAAAACGTTTTCTTCGAGGATGCGACTAAAAGTGCACTTAAGGAACCATGCCGGGGAAGAGCCGTTCTCTTGCACAATTTGCGACAAAACTTTCTCTAGCGATGGGGCCTTGAAGAGCCACTTAACGATTCACGCCGGTGAAGAACGGTTCCCTTGCACTCTTTGCGAGAAGAAGTTCTCCACGAATAAGTACCTGAAGAATCACCTAAAGAGGCATTCCGGGGAAAAGCCGTTCTCGTGCACGATTTGCAATAAGCTGTTCTCTGCCAATAGGAACTTGAAGAGTCACCTACGGAGTCACGCTGGGGAAAAACCGTTTGCGTGCATTATTTGCAATAAGAAATTTGTTGCGAAGAGGAACTTGAGGAGTCACCTGCGACTGCATGCTAGCGATGAGTTGCTTtcgtgtacaatttgcgaTAAAAAATTTACGAGGAATGACAATTTAAAGAAGCACTTTGAACGTCATACTGGAAACAAGGATAAATga
Protein Sequence
MELSQEQLGNHSTEKPFHCPLCDKTFSRNAGMKVHLRSHTGEKPYPCNVCEKTFASTHGLKYHLSSHSGEKPYSCTLCDKTFARGDYLKLHMSIHTGEKPFPCTICDKTFSSRMRLKVHLRNHAGEEPFSCTICDKTFSSDGALKSHLTIHAGEERFPCTLCEKKFSTNKYLKNHLKRHSGEKPFSCTICNKLFSANRNLKSHLRSHAGEKPFACIICNKKFVAKRNLRSHLRLHASDELLSCTICDKKFTRNDNLKKHFERHTGNKDK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01287425;
90% Identity
iTF_01287425;
80% Identity
iTF_01287425;