Pumb015759.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Pyrrhia umbra
Gene Symbol
sox8
Assembly
GCA_963891755.1
Location
OY982929.1:5929190-5947188[+]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 1.3e-27 1.3e-24 87.3 1.8 1 69 48 116 48 116 0.99

Sequence Information

Coding Sequence
ATGAGCTGGGAACAAGATCGCAATCGGCCCTGTGATAAGCTGGAAATTAATGAAGCGGTCGGAAAACTTTTGGAAAGCTTCAATTATGACAGCATTGTACCGCAACCGACGAgGGGTGGTGGCTGTATGCGGCGTGCGCACGTGAAAAGACCCATGAATGCGTTCATGGTGTTTGCACAAGCGATGCGCAGGCGCCTCTCTGAGCAGCGGCCTGCGCTACACAACGCTGAATTAAGCAAATCTTTAGGATCCATGTGGAAAAGTTTGAGCGAAGACGAGAAGTTACCCTTCATTAAGGAGGCTGATAAGCTCCGAACGCAGCATAAGAAGGAATATCCCGATTACAAATACCAACCACGGCGTCGCAAGCCTCAGCCGACGTCAGCAGTTCGGCCAAAGCGAGAGCCTTCCCCGGAGAGAGATCAGATTGATTTCGCTGGCATGCCGGACATCTCGCCAGCACTGTTGGCGGACGGCCCACCAGATAATGCAGAATTGGAGCAATACTTGAAGCCAGGCTCGGTGCCAGACTACCACGAGCTACAGCCGAGGTATGCCGCCCACAGCCTCCACCACGCACCACCACCCCTGTACGCCCCAGTACCGCCTCATCTCCACCCCGCGTGTGCAGACTGGCAACACTACACGGGACACccttaa
Protein Sequence
MSWEQDRNRPCDKLEINEAVGKLLESFNYDSIVPQPTRGGGCMRRAHVKRPMNAFMVFAQAMRRRLSEQRPALHNAELSKSLGSMWKSLSEDEKLPFIKEADKLRTQHKKEYPDYKYQPRRRKPQPTSAVRPKREPSPERDQIDFAGMPDISPALLADGPPDNAELEQYLKPGSVPDYHELQPRYAAHSLHHAPPPLYAPVPPHLHPACADWQHYTGHP