Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0022 6.2 7.0 0.1 27 44 29 46 26 50 0.91

2 4 0.015 43 4.3 0.0 21 44 51 74 47 81 0.89

3 4 0.034 95 3.2 0.0 22 46 80 104 75 108 0.87

4 4 9e-05 0.25 11.4 0.1 22 44 108 130 105 134 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0022	6.2	7.0	0.1	27	44	29	46	26	50	0.91
2	4	0.015	43	4.3	0.0	21	44	51	74	47	81	0.89
3	4	0.034	95	3.2	0.0	22	46	80	104	75	108	0.87
4	4	9e-05	0.25	11.4	0.1	22	44	108	130	105	134	0.87

Coding Sequence: ATGAAAAACGGTACGAGTGTAATATTTGCGGagagaaatttattcattGGAACAGTAAACGAAGTCATATTAGAGCTttataaatgtcatatttgtGGAAAAAAATTCGCTCAAAGTAGTAATCTGTTTCGTCATATAAGACAACATACTGGAGAATTGCCGCACGAATGTGAGTTTTGTCACAAAAAATTTGTATCTTCTCCAGAACTTCGGAACCATTTGGTAACGcataccaaagaaaaaaatgaaatatgcgAAGTATGTAAAAAAGCCTTCGGAACGAAAAAAGCACTAAGAACACACTTAAAAATACACACTGGTGAAAGAAATTACAAATGCCCCATATGTTTCAAAGCTTTTACACAGGCGCATGTATTGCGTTCACATTTTAAGACACATCCAGACTGTCCAGTACCACCGCCAGGATCAATTTTATCTCAAAAGGCATTAAACAAACACCCTTTAATGCAAagtatataa
Protein Sequence: MKNGTSVIFAERNLFIGTVNEVILELYKCHICGKKFAQSSNLFRHIRQHTGELPHECEFCHKKFVSSPELRNHLVTHTKEKNEICEVCKKAFGTKKALRTHLKIHTGERNYKCPICFKAFTQAHVLRSHFKTHPDCPVPPPGSILSQKALNKHPLMQSI

Sequence clustering based on sequence similarity using MMseqs2