Pcon009188.1
Basic Information
- Insect
- Ptychoptera contaminata
- Gene Symbol
- -
- Assembly
- GCA_963942525.1
- Location
- OZ012638.1:3805351-3805752[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 4e-12 2.8e-09 36.8 6.0 4 62 18 76 16 79 0.94 2 2 9.5 6.7e+03 -2.9 0.1 28 35 86 93 81 100 0.52
Sequence Information
- Coding Sequence
- atgccgTCTAAAAAGAAAGTTGACAAGTCCTCGGATGGGGAATTTGATGatgattatagaaaaaaaagagatCGTAATAATCAGGCTGTCAAACGTAGTAGAgcaaaaacaaagcaaaaaacgaAGGAAACCCAACACAGAGTGACAGAGCTTAAAgtgaaaaatcaaatattggAAGACCGaataaaaaatctaacaaaagatttacaatttttaaaagaattatttatgggATTAGCTAAACCAAAGTCTGAAAAAGAAATCGAAAtggaattagaaaaaatattagccGATGACGATGAGGACGATGAAGTACCATTGAAATGTGAATAA
- Protein Sequence
- MPSKKKVDKSSDGEFDDDYRKKRDRNNQAVKRSRAKTKQKTKETQHRVTELKVKNQILEDRIKNLTKDLQFLKELFMGLAKPKSEKEIEMELEKILADDDEDDEVPLKCE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01276026;
- 90% Identity
- iTF_01276026;
- 80% Identity
- -