Palb008604.1
Basic Information
- Insect
- Ptychoptera albimana
- Gene Symbol
- -
- Assembly
- GCA_961205885.1
- Location
- OY540804.1:11638702-11639101[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 3.7e-12 2.3e-09 36.8 6.0 4 62 18 76 16 79 0.94 2 2 6.3 3.9e+03 -2.4 0.1 24 45 86 107 84 109 0.57
Sequence Information
- Coding Sequence
- ATGCCATCTAAAAAGAAAGTTGATAAATCGTCTGACGGAGaatttgatgatgattatagaaaaaaaagggatAGGAACAATCagGCAGTCAAACGAAGTAGagcaaaaacaaagcaaaaaacgaAGGAAACCCAGCACAGAGTAACAGAACTTAaagttaaaaatcaaatattggAAGAcaggattaaaaatttaacaaaggaTTTACAGTTCTTAAAAGAACTTTTTATGGGATTAGCCAAACCAAAATCTgagaaggaaataaaaatggaattagaaaaaattttagctgatgacgatgatgatgatttaaatttgaagagtgaataa
- Protein Sequence
- MPSKKKVDKSSDGEFDDDYRKKRDRNNQAVKRSRAKTKQKTKETQHRVTELKVKNQILEDRIKNLTKDLQFLKELFMGLAKPKSEKEIKMELEKILADDDDDDLNLKSE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01276721;
- 90% Identity
- iTF_01276721;
- 80% Identity
- -